ST3GAL6 (NM_006100) Human Recombinant Protein

ST3GAL6 protein,

Recombinant protein of human ST3 beta-galactoside alpha-2,3-sialyltransferase 6 (ST3GAL6)

Product Info Summary

SKU: PROTQ9Y274
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

ST3GAL6 (NM_006100) Human Recombinant Protein

View all ST3GAL6 recombinant proteins

SKU/Catalog Number

PROTQ9Y274

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ST3 beta-galactoside alpha-2,3-sialyltransferase 6 (ST3GAL6)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

ST3GAL6 (NM_006100) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y274)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

38.214kDa

Amino Acid Sequence

MRGYLVAIFLSAVFLYYVLHCILWGTNVYWVAPVEMKRRNKIQPCLSKPAFASLLRFHQFHPFLCAADFRKIASLYGSDKFDLPYGMRTSAEYFRLALSKLQSCDLFDEFDNIPCKKCVVVGNGGVLKNKTLGEKIDSYDVIIRMNNGPVLGHEEEVGRRTTFRLFYPESVFSDPIHNDPNTTVILTAFKPHDLRWLLELLMGDKINTNGFWKKPALNLIYKPYQIRILDPFIIRTAAYELLHFPKVFPKNQKPKHPTTGIIAITLAFYICHEVHLAGFKYNFSDLKSPLHYYGNATMSLMNKNAYHNVTAEQLFLKDIIEKNLVINLTQD

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Validation Images & Assay Conditions

Gene/Protein Information For ST3GAL6 (Source: Uniprot.org, NCBI)

Gene Name

ST3GAL6

Full Name

Type 2 lactosamine alpha-2,3-sialyltransferase

Weight

38.214kDa

Superfamily

glycosyltransferase 29 family

Alternative Names

alpha2,3-sialyltransferase; CMP-NeuAc:beta-galactoside alpha-2,3-sialyltransferase VI; EC 2.4.99; EC 2.4.99.-; EC 2.4.99.9; Sialyltransferase 10; SIAT10; ST3 beta-galactoside alpha-2,3-sialyltransferase 6; ST3Gal VI; ST3GAL6; ST3GALVI; ST3GALVIsialyltransferase 10 (alpha-2,3-sialyltransferase VI); type 2 lactosamine alpha-2,3-sialyltransferase ST3GAL6 SIAT10, ST3GALVI ST3 beta-galactoside alpha-2,3-sialyltransferase 6 type 2 lactosamine alpha-2,3-sialyltransferase|CMP-NeuAc:beta-galactoside alpha-2,3-sialyltransferase VI|alpha2,3-sialyltransferase ST3Gal VI|sialyltransferase 10 (alpha-2,3-sialyltransferase VI)

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ST3GAL6, check out the ST3GAL6 Infographic

ST3GAL6 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ST3GAL6: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y274

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ST3GAL6 (NM_006100) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review ST3GAL6 (NM_006100) Human Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ST3GAL6 (NM_006100) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y274
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.