TNFAIP8 (NM_014350) Human Recombinant Protein

TNFAIP8 protein,

Cited in 1 publication(s).

Product Info Summary

SKU: PROTO95379
Size: 20 µg
Source: HEK293T

Product Name

TNFAIP8 (NM_014350) Human Recombinant Protein

View all TNFAIP8 recombinant proteins

SKU/Catalog Number

PROTO95379

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

TNFAIP8 (NM_014350) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO95379)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

23.003kDa

Amino Acid Sequence

MHSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Validation Images & Assay Conditions

Gene/Protein Information For TNFAIP8 (Source: Uniprot.org, NCBI)

Gene Name

TNFAIP8

Full Name

Tumor necrosis factor alpha-induced protein 8

Weight

23.003kDa

Superfamily

TNFAIP8 family

Alternative Names

GG2-1; Head and neck tumor and metastasis-related protein; MDC-3.13TNF-induced protein GG2-1; NDED; NF-kappa-B-inducible DED-containing protein; SCC-S2SCCS2; TNF alpha-induced protein 8; tumor necrosis factor alpha-induced protein 8; tumor necrosis factor, alpha-induced protein 8 TNFAIP8 GG2-1, MDC-3.13, NDED, SCC-S2, SCCS2 TNF alpha induced protein 8 tumor necrosis factor alpha-induced protein 8|NF-kappa-B-inducible DED-containing protein|TNF-induced protein GG2-1|head and neck tumor and metastasis-related protein|tumor necrosis factor, alpha induced protein 8

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TNFAIP8, check out the TNFAIP8 Infographic

TNFAIP8 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TNFAIP8: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

PROTO95379 has been cited in 1 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Neutrophil activation and neutrophil-derived neutrophil extracellular trap formation in patients with coronary artery ectasia, Yuchao Guo, Ruifeng Liu, Lianfeng Chen,Wei Wu, and Shuyang Zhang BMC Cardiovascular Disorders

Have you used TNFAIP8 (NM_014350) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review TNFAIP8 (NM_014350) Human Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TNFAIP8 (NM_014350) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO95379
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.