AGR3 (NM_176813) Human Recombinant Protein

AG-3/AGR3 protein,

Product Info Summary

SKU: PROTQ8TD06
Size: 20 µg
Source: HEK293T

Product Name

AGR3 (NM_176813) Human Recombinant Protein

View all AG-3/AGR3 recombinant proteins

SKU/Catalog Number

PROTQ8TD06

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human anterior gradient homolog 3 (Xenopus laevis) (AGR3)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

AGR3 (NM_176813) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8TD06)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

19.171kDa

Amino Acid Sequence

MMLHSALGLCLLLVTVSSNLAIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLEDCQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRLYTYEPRDLPLLIENMKKALRLIQSEL

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Validation Images & Assay Conditions

Gene/Protein Information For AGR3 (Source: Uniprot.org, NCBI)

Gene Name

AGR3

Full Name

Anterior gradient protein 3

Weight

19.171kDa

Superfamily

AGR family

Alternative Names

AG3; AG-3; AGR3; anterior gradient homolog 3 (Xenopus laevis); BCMP11; BCMP11AG3; Breast cancer membrane protein 11; hAG-3member 18; PDIA18 AGR3 AG-3, AG3, BCMP11, HAG3, PDIA18, hAG-3 anterior gradient 3, protein disulphide isomerase family member anterior gradient protein 3|anterior gradient homolog 3|anterior gradient protein 3 homolog|breast cancer membrane protein 11|protein disulfide isomerase family A, member 18

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on AGR3, check out the AGR3 Infographic

AGR3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for AGR3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8TD06

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used AGR3 (NM_176813) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review AGR3 (NM_176813) Human Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for AGR3 (NM_176813) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8TD06
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.