alpha 1 Antitrypsin (SERPINA1) (NM_001127701) Human Recombinant Protein

Serpin A1/alpha 1-Antitrypsin protein,

Product Info Summary

SKU: PROTP01009
Size: 20 µg
Source: HEK293T

Product Name

alpha 1 Antitrypsin (SERPINA1) (NM_001127701) Human Recombinant Protein

View all Serpin A1/alpha 1-Antitrypsin recombinant proteins

SKU/Catalog Number

PROTP01009

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 5

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

alpha 1 Antitrypsin (SERPINA1) (NM_001127701) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP01009)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

46.737kDa

Amino Acid Sequence

MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIDQNTKSPLFMGKVVNPTQK

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Validation Images & Assay Conditions

There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.

Gene/Protein Information For SERPINA1 (Source: Uniprot.org, NCBI)

Gene Name

SERPINA1

Full Name

Alpha-1-antitrypsin

Weight

46.737kDa

Superfamily

serpin family

Alternative Names

A1A; A1AT; AATMGC23330; alpha 1-Antitrypsin; alpha 1-Proteinase Inhibitor; Alpha-1 protease inhibitor; Alpha-1-antiproteinase; alpha-1-antitrypsin; antitrypsin), member 1; member 1; PIMGC9222; serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase; serine (or cysteine) proteinase inhibitor, clade A, member 1; Serpin A1; serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin) SERPINA1 A1A, A1AT, AAT, PI, PI1, PRO2275, alpha1AT, nNIF serpin family A member 1 alpha-1-antitrypsin|alpha-1 antitrypsin|alpha-1 protease inhibitor|alpha-1-antiproteinase|alpha-1-antitrypsin short transcript variant 1C4|alpha-1-antitrypsin short transcript variant 1C5|epididymis secretory sperm binding protein|protease inhibitor 1 (anti-elastase), alpha-1-antitrypsin|serine (or cysteine) proteinase inhibitor, clade A, member 1|serpin A1|serpin peptidase inhibitor clade A (alpha-1antiproteinase, antitrypsin) member 1|serpin peptidase inhibitor clade A member 1|serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SERPINA1, check out the SERPINA1 Infographic

SERPINA1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SERPINA1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP01009

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used alpha 1 Antitrypsin (SERPINA1) (NM_001127701) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review alpha 1 Antitrypsin (SERPINA1) (NM_001127701) Human Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for alpha 1 Antitrypsin (SERPINA1) (NM_001127701) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP01009
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.