Anti-ASXL1 Antibody Picoband™

ASXL1 antibody

Boster Bio Anti-ASXL1 Antibody Picoband™ catalog # A01099. Tested in Flow Cytometry, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A01099
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, WB

Customers Who Bought This Also Bought

Product Name

Anti-ASXL1 Antibody Picoband™

View all ASXL1 Antibodies

SKU/Catalog Number

A01099

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-ASXL1 Antibody Picoband™ catalog # A01099. Tested in Flow Cytometry, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-ASXL1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01099)

Host

Rabbit

Contents

Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human ASXL1, identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A01099 is reactive to ASXL1 in Human, Mouse, Rat

Applications

A01099 is guaranteed for Flow Cytometry, WB Boster Guarantee

Observed Molecular Weight

165 kDa

Calculated molecular weight

165.432kDa

Background of ASXL1

Putative Polycomb group protein ASXL1 is a protein that in humans is encoded by the ASXL1 gene. This gene is similar to the Drosophila additional sex combs gene, which encodes a chromatin-binding protein required for normal determination of segment identity in the developing embryo. The protein is a member of the Polycomb group of proteins, which are necessary for the maintenance of stable repression of homeotic and other loci. The protein is thought to disrupt chromatin in localized areas, enhancing transcription of certain genes while repressing the transcription of other genes. The protein encoded by this gene functions as a ligand-dependent co-activator for retinoic acid receptor in cooperation with nuclear receptor coactivator 1. Mutations in this gene are associated with myelodysplastic syndromes and chronic myelomonocytic leukemia. Alternative splicing results in multiple transcript variants.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Flow Cytometry, 1-3μg/1x106 cells

Validation Images & Assay Conditions

Gene/Protein Information For ASXL1 (Source: Uniprot.org, NCBI)

Gene Name

ASXL1

Full Name

Polycomb group protein ASXL1

Weight

165.432kDa

Superfamily

Asx family

Alternative Names

additional sex combs like 1 (Drosophila) ASXL1 BOPS, MDS ASXL transcriptional regulator 1 polycomb group protein ASXL1|additional sex combs like 1, transcriptional regulator|additional sex combs like transcriptional regulator 1|putative Polycomb group protein ASXL1

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on ASXL1, check out the ASXL1 Infographic

ASXL1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ASXL1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A01099

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-ASXL1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review Anti-ASXL1 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

4 Customer Q&As for Anti-ASXL1 Antibody Picoband™

Question

Is this A01099 anti-ASXL1 antibody reactive to the isotypes of ASXL1?

A. Brown

Verified customer

Asked: 2020-03-12

Answer

The immunogen of A01099 anti-ASXL1 antibody is A synthetic peptide corresponding to a sequence of human ASXL1 (KKERTWAEAARLVLENYSDAPMTPKQILQVIEAE). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-03-12

Question

I have a question about product A01099, anti-ASXL1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2020-01-28

Answer

We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A01099 anti-ASXL1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2020-01-28

Question

I was wanting to use your anti-ASXL1 antibody for WB for human prostate on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human prostate identification?

Verified Customer

Verified customer

Asked: 2019-07-09

Answer

It shows on the product datasheet, A01099 anti-ASXL1 antibody has been validated for Flow Cytometry, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human prostate in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-07-09

Question

Would A01099 anti-ASXL1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

F. Miller

Verified customer

Asked: 2016-12-06

Answer

You can see on the product datasheet, A01099 anti-ASXL1 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2016-12-06

Order DetailsPrice
A01099

100μg

$370
A01099-10ug

10μg sample (liquid)

$99
A01099-Biotin

100 μg Biotin conjugated

$570
A01099-Cy3

100 μg Cy3 conjugated

$570
A01099-Dylight488

100 μg Dylight488 conjugated

$570
A01099-Dylight550

100 μg Dylight550 conjugated

$570
A01099-Dylight594

100 μg Dylight594 conjugated

$570
A01099-FITC

100 μg FITC conjugated

$570
A01099-HRP

100 μg HRP conjugated

$570
A01099-APC

100 μg APC conjugated

$670
A01099-PE

100 μg PE conjugated

$670
A01099-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A01099
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.