Anti-Connexin 45/GJA7/GJC1 Antibody Picoband™

Boster Bio Anti-Connexin 45/GJA7/GJC1 Antibody Picoband™ catalog # A08562. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. Cited in 1 publication(s).

Product Info Summary

SKU: A08562
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC, WB

Product Name

Anti-Connexin 45/GJA7/GJC1 Antibody Picoband™

See all Connexin 45/GJC1 products

SKU/Catalog Number







Boster Bio Anti-Connexin 45/GJA7/GJC1 Antibody Picoband™ catalog # A08562. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Connexin 45/GJA7/GJC1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A08562)




Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence at the N-terminus of human Connexin 45/GJA7 (91-131aa YLGYAIHKIAKMEHGEADKKAARSKPYAMRWKQHRALEETE), identical to the related mouse and rat sequences.

Cross Reactivity

No cross reactivity with other proteins

Reactive Species

A08562 is reactive to GJC1 in Human, Mouse, Rat


A08562 is guaranteed for IHC, WB Boster Guarantee

*Blocking peptide can be purchased at $150. Contact us for more information.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Western blot, 0.1-0.5μg/ml, Rat, Human

Validation Images & Assay Conditions

Gene/Protein Information For GJC1 (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Gap junction gamma-1 protein




connexin family

Alternative Names

Connexin 45; connexin-45; CX45; DKFZp686P0738; Gap junction alpha-7 protein; gap junction gamma-1 protein; gap junction protein, alpha 7, 45kDa; gap junction protein, gamma 1, 45kDa; GJA7; GJC1 GJC1 CX45, GJA7 gap junction protein gamma 1 gap junction gamma-1 protein|CTC-296K1.4|connexin-45|gap junction alpha-7 protein|gap junction protein, gamma 1, 45kDa

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on GJC1, check out the GJC1 Infographic

GJC1 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for GJC1: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

A08562 has been cited in 1 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Effect of Novel Gasotransmitter hydrogen sulfide on renal fibrosis and connexins expression in diabetic rats

Have you used Anti-Connexin 45/GJA7/GJC1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-Connexin 45/GJA7/GJC1 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

3 Customer Q&As for Anti-Connexin 45/GJA7/GJC1 Antibody Picoband™


See attached the WB image, lot number and protocol we used for neocortex using anti-Connexin 45/GJA7/GJC1 antibody A08562. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-12-16


Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-12-16


I see that the anti-Connexin 45/GJA7/GJC1 antibody A08562 works with IHC, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-10-22


You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-10-22


I was wanting to use your anti-Connexin 45/GJA7/GJC1 antibody for IHC for rat neocortex on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for rat neocortex identification?

W. Jackson

Verified customer

Asked: 2019-03-05


As indicated on the product datasheet, A08562 anti-Connexin 45/GJA7/GJC1 antibody has been validated for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat neocortex in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-03-05



Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)

$50 fee for conjugation. Antibody size is reduced to 50ug.



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.