Anti-Caseine Kinase 1 alpha/CSNK1A1 Antibody Picoband™

Casein Kinase 1 alpha antibody

Boster Bio Anti-Caseine Kinase 1 alpha/CSNK1A1 Antibody Picoband™ catalog # PB9693. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: PB9693
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC, WB

Product Name

Anti-Caseine Kinase 1 alpha/CSNK1A1 Antibody Picoband™

View all Casein Kinase 1 alpha Antibodies

SKU/Catalog Number

PB9693

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Caseine Kinase 1 alpha/CSNK1A1 Antibody Picoband™ catalog # PB9693. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Caseine Kinase 1 alpha/CSNK1A1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9693)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human CSNK1A1, identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9693 is reactive to CSNK1A1 in Human, Mouse, Rat

Applications

PB9693 is guaranteed for IHC, WB Boster Guarantee

Observed Molecular Weight

39 kDa

Calculated molecular weight

38.915kDa

Background of Casein Kinase 1 alpha

Casein kinase I isoform alpha is an enzyme that in humans is encoded by the CSNK1A1 gene. The CSNK1A1 gene is mapped to chromosome 5q32 based on an alignment of the CSNK1A1 sequence with the genomic sequence (GRCh37). It is reported that both screens identified CK1-alpha as a bifunctional regulator of NF-kappa-B. CK1-alpha dynamically associates with the CBM complex on T cell receptor engagement to participate in cytokine production and lymphocyte proliferation. However, CK1-alpha kinase activity has a contrasting role by subsequently promoting the phosphorylation and inactivation of CARMA1. CK1-alpha has thus a dual 'gating' function which first promotes and then terminates receptor-induced NF-kappa-B. ABC DLBCL cells required CK1-alpha for constitutive NF-kappa-B activity, indicating that CK1-alpha functions as a conditionally essential malignancy gene. 

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat

Validation Images & Assay Conditions

Gene/Protein Information For CSNK1A1 (Source: Uniprot.org, NCBI)

Gene Name

CSNK1A1

Full Name

Casein kinase I isoform alpha

Weight

38.915kDa

Superfamily

protein kinase superfamily

Alternative Names

Casein Kinase 1 alpha; casein kinase 1, alpha 1; casein kinase I isoform alpha; CK1CKI-alpha; CSNK1A1; down-regulated in lung cancer; EC 2.7.11.1; HLCDGP1; PRO2975 CSNK1A1 CK1, CK1a, CKIa, HEL-S-77p, HLCDGP1, PRO2975 casein kinase 1 alpha 1 casein kinase I isoform alpha|CKI-alpha|clock regulator kinase|down-regulated in lung cancer|epididymis secretory sperm binding protein Li 77p

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on CSNK1A1, check out the CSNK1A1 Infographic

CSNK1A1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CSNK1A1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for PB9693

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Caseine Kinase 1 alpha/CSNK1A1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review Anti-Caseine Kinase 1 alpha/CSNK1A1 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

7 Customer Q&As for Anti-Caseine Kinase 1 alpha/CSNK1A1 Antibody Picoband™

Question

Is a blocking peptide available for product anti-Caseine Kinase 1 alpha/CSNK1A1 antibody (PB9693)?

Verified Customer

Verified customer

Asked: 2020-04-24

Answer

We do provide the blocking peptide for product anti-Caseine Kinase 1 alpha/CSNK1A1 antibody (PB9693). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2020-04-24

Question

Do you have a BSA free version of anti-Caseine Kinase 1 alpha/CSNK1A1 antibody PB9693 available?

Verified Customer

Verified customer

Asked: 2019-12-27

Answer

Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-Caseine Kinase 1 alpha/CSNK1A1 antibody PB9693 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-12-27

Question

Is this PB9693 anti-Caseine Kinase 1 alpha/CSNK1A1 antibody reactive to the isotypes of CSNK1A1?

A. Jones

Verified customer

Asked: 2019-11-27

Answer

The immunogen of PB9693 anti-Caseine Kinase 1 alpha/CSNK1A1 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human CSNK1A1 (30-68aa DIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQ), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-11-27

Question

We are currently using anti-Caseine Kinase 1 alpha/CSNK1A1 antibody PB9693 for rat tissue, and we are well pleased with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on bovine tissues as well?

Verified Customer

Verified customer

Asked: 2019-10-18

Answer

The anti-Caseine Kinase 1 alpha/CSNK1A1 antibody (PB9693) has not been validated for cross reactivity specifically with bovine tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in bovine you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-10-18

Question

Does PB9693 anti-Caseine Kinase 1 alpha/CSNK1A1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2019-10-04

Answer

It shows on the product datasheet, PB9693 anti-Caseine Kinase 1 alpha/CSNK1A1 antibody as been validated on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-10-04

Question

See below the WB image, lot number and protocol we used for cervix carcinoma using anti-Caseine Kinase 1 alpha/CSNK1A1 antibody PB9693. Please let me know if you require anything else.

P. Collins

Verified customer

Asked: 2018-03-29

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-03-29

Question

I was wanting to use your anti-Caseine Kinase 1 alpha/CSNK1A1 antibody for IHC for mouse cervix carcinoma on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for mouse cervix carcinoma identification?

J. Parker

Verified customer

Asked: 2013-08-14

Answer

You can see on the product datasheet, PB9693 anti-Caseine Kinase 1 alpha/CSNK1A1 antibody has been tested for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse cervix carcinoma in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2013-08-14

Order DetailsPrice
PB9693

100μg

$370
PB9693-10ug

10μg sample (liquid)

$99
PB9693-Biotin

100 μg Biotin conjugated

$570
PB9693-Cy3

100 μg Cy3 conjugated

$570
PB9693-Dylight488

100 μg Dylight488 conjugated

$570
PB9693-Dylight550

100 μg Dylight550 conjugated

$570
PB9693-Dylight594

100 μg Dylight594 conjugated

$570
PB9693-FITC

100 μg FITC conjugated

$570
PB9693-HRP

100 μg HRP conjugated

$570
PB9693-APC

100 μg APC conjugated

$670
PB9693-PE

100 μg PE conjugated

$670
PB9693-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9693
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.