Product Info Summary
| SKU: | A02274 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-FGF9 Antibody Picoband®
SKU/Catalog Number
A02274
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-FGF9 Antibody Picoband® catalog # A02274. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-FGF9 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A02274)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human FGF9, identical to the related mouse and rat sequences.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A02274 is reactive to FGF9 in Human, Mouse, Rat
Observed Molecular Weight
26 kDa
Calculated molecular weight
23.4 kDa
Background of FGF9
FGF 9, Fibroblast growth factor 9, is a protein that in humans is encoded by the FGF9 gene. The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. The FGF 9 gene contains 3 exons. By radioactive chromosomal in situ hybridization, the FGF 9 gene is mapped to chromosome 13q11-q12. This protein was isolated as a secreted factor that exhibits a growth-stimulating effect on cultured glial cells. In nervous system, this protein is produced mainly by neurons and may be important for glial cell development. Expression of the mouse homolog of this gene was found to be dependent on Sonic hedgehog (Shh) signaling.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A02274 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Positive Control
WB: human COLO-320 whole cell, rat brain tissue, mouse brain tissue
Validation Images & Assay Conditions
Click image to see more details
Western blot analysis of FGF9 using anti-FGF9 antibody (A02274).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human COLO-320 whole cell lysates,
Lane 2: rat brain tissue lysates,
Lane 3: mouse brain tissue lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-FGF9 antigen affinity purified polyclonal antibody (Catalog # A02274) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for FGF9 at approximately 26KD. The expected band size for FGF9 is at 23KD.
Specific Publications For Anti-FGF9 Antibody Picoband® (A02274)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-FGF9 Antibody Picoband®?
Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.
0 Reviews For Anti-FGF9 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
6 Customer Q&As for Anti-FGF9 Antibody Picoband®
Question
Will anti-FGF9 antibody A02274 work for WB with glial tumor?
Verified Customer
Verified customer
Asked: 2019-08-13
Answer
According to the expression profile of glial tumor, FGF9 is highly expressed in glial tumor. So, it is likely that anti-FGF9 antibody A02274 will work for WB with glial tumor.
Boster Scientific Support
Answered: 2019-08-13
Question
I see that the anti-FGF9 antibody A02274 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2019-06-26
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to support@bosterbio.com
Boster Scientific Support
Answered: 2019-06-26
Question
I was wanting to use your anti-FGF9 antibody for WB for human glial tumor on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human glial tumor identification?
Verified Customer
Verified customer
Asked: 2018-12-28
Answer
You can see on the product datasheet, A02274 anti-FGF9 antibody has been validated for WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human glial tumor in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2018-12-28
Question
I have attached the WB image, lot number and protocol we used for glial tumor using anti-FGF9 antibody A02274. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2018-12-17
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2018-12-17
Question
I would like to test anti-FGF9 antibody A02274 on human glial tumor for research purposes, then I may be interested in using anti-FGF9 antibody A02274 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2017-10-06
Answer
The products we sell, including anti-FGF9 antibody A02274, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2017-10-06
Question
Is this A02274 anti-FGF9 antibody reactive to the isotypes of FGF9?
Verified Customer
Verified customer
Asked: 2017-08-10
Answer
The immunogen of A02274 anti-FGF9 antibody is A synthetic peptide corresponding to a sequence of human FGF9 (DHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLY). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2017-08-10


