Anti-FGF9 Antibody Picoband®

FGF9 antibody

Boster Bio Anti-FGF9 Antibody Picoband® catalog # A02274. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Product Info Summary

SKU: A02274
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: WB

Customers Who Bought This Also Bought

Product Name

Anti-FGF9 Antibody Picoband®

View all FGF9 Antibodies

SKU/Catalog Number

A02274

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-FGF9 Antibody Picoband® catalog # A02274. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-FGF9 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A02274)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human FGF9, identical to the related mouse and rat sequences.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A02274 is reactive to FGF9 in Human, Mouse, Rat

Observed Molecular Weight

26 kDa

Calculated molecular weight

23.4 kDa

Background of FGF9

FGF 9, Fibroblast growth factor 9, is a protein that in humans is encoded by the FGF9 gene. The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. The FGF 9 gene contains 3 exons. By radioactive chromosomal in situ hybridization, the FGF 9 gene is mapped to chromosome 13q11-q12. This protein was isolated as a secreted factor that exhibits a growth-stimulating effect on cultured glial cells. In nervous system, this protein is produced mainly by neurons and may be important for glial cell development. Expression of the mouse homolog of this gene was found to be dependent on Sonic hedgehog (Shh) signaling.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A02274 is guaranteed for WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml

Positive Control

WB: human COLO-320 whole cell, rat brain tissue, mouse brain tissue

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-FGF9 Antibody Picoband®?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

0 Reviews For Anti-FGF9 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

6 Customer Q&As for Anti-FGF9 Antibody Picoband®

Question

Will anti-FGF9 antibody A02274 work for WB with glial tumor?

Verified Customer

Verified customer

Asked: 2019-08-13

Answer

According to the expression profile of glial tumor, FGF9 is highly expressed in glial tumor. So, it is likely that anti-FGF9 antibody A02274 will work for WB with glial tumor.

Boster Scientific Support

Answered: 2019-08-13

Question

I see that the anti-FGF9 antibody A02274 works with WB, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-06-26

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to support@bosterbio.com

Boster Scientific Support

Answered: 2019-06-26

Question

I was wanting to use your anti-FGF9 antibody for WB for human glial tumor on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human glial tumor identification?

Verified Customer

Verified customer

Asked: 2018-12-28

Answer

You can see on the product datasheet, A02274 anti-FGF9 antibody has been validated for WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human glial tumor in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2018-12-28

Question

I have attached the WB image, lot number and protocol we used for glial tumor using anti-FGF9 antibody A02274. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2018-12-17

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-12-17

Question

I would like to test anti-FGF9 antibody A02274 on human glial tumor for research purposes, then I may be interested in using anti-FGF9 antibody A02274 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2017-10-06

Answer

The products we sell, including anti-FGF9 antibody A02274, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2017-10-06

Question

Is this A02274 anti-FGF9 antibody reactive to the isotypes of FGF9?

Verified Customer

Verified customer

Asked: 2017-08-10

Answer

The immunogen of A02274 anti-FGF9 antibody is A synthetic peptide corresponding to a sequence of human FGF9 (DHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLY). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2017-08-10

Order DetailsPrice
A02274

100μg

$370
A02274-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
A02274-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
A02274-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
A02274-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
A02274-APC

100 μg APC conjugated (liquid)

$820
A02274-FITC

100 μg FITC conjugated (liquid)

$570
A02274-Cy3

100 μg Cy3 conjugated (liquid)

$570
A02274-Biotin

100 μg Biotin conjugated (liquid)

$570
A02274-HRP

100 μg HRP conjugated (liquid)

$570
A02274-PE

100 μg PE conjugated (liquid)

$820
A02274-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
A02274
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: May 8, 2026