Anti-FZD3 Antibody Picoband™

Frizzled-3 antibody

Boster Bio Anti-FZD3 Antibody Picoband™ catalog # A04680-1. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A04680-1
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC, WB

Customers Who Bought This Also Bought

Product Name

Anti-FZD3 Antibody Picoband™

View all Frizzled-3 Antibodies

SKU/Catalog Number

A04680-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-FZD3 Antibody Picoband™ catalog # A04680-1. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-FZD3 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A04680-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human FZD3, identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A04680-1 is reactive to FZD3 in Human, Mouse, Rat

Applications

A04680-1 is guaranteed for IHC, WB Boster Guarantee

Observed Molecular Weight

76 kDa

Calculated molecular weight

76.263kDa

Background of Frizzled-3

Frizzled-3 is a protein that in humans is encoded by the FZD3 gene. This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. The function of this protein is unknown, although it may play a role in mammalian hair follicle development. Alternative splicing results in multiple transcript variants. This gene is a susceptibility locus for schizophrenia.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml

Validation Images & Assay Conditions

Gene/Protein Information For FZD3 (Source: Uniprot.org, NCBI)

Gene Name

FZD3

Full Name

Frizzled-3

Weight

76.263kDa

Superfamily

G-protein coupled receptor Fz/Smo family

Alternative Names

frizzled (Drosophila) homolog 3; frizzled homolog 3 (Drosophila); Frizzled3; Frizzled-3; Fz-3; FZD3; hFz3 FZD3 Fz-3 frizzled class receptor 3 frizzled-3|frizzled 3, seven transmembrane spanning receptor|frizzled family receptor 3|frizzled homolog 3

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on FZD3, check out the FZD3 Infographic

FZD3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FZD3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A04680-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-FZD3 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review Anti-FZD3 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

13 Customer Q&As for Anti-FZD3 Antibody Picoband™

Question

Will anti-FZD3 antibody A04680-1 work for WB with keratinocyte?

Verified Customer

Verified customer

Asked: 2020-05-07

Answer

According to the expression profile of keratinocyte, FZD3 is highly expressed in keratinocyte. So, it is likely that anti-FZD3 antibody A04680-1 will work for WB with keratinocyte.

Boster Scientific Support

Answered: 2020-05-07

Question

Is this A04680-1 anti-FZD3 antibody reactive to the isotypes of FZD3?

G. Anderson

Verified customer

Asked: 2020-02-21

Answer

The immunogen of A04680-1 anti-FZD3 antibody is A synthetic peptide corresponding to a sequence of human FZD3 (MPNLLNHYDQQTAALAMEPFHPMVNLDCSRDFRPFL). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-02-21

Question

See below the WB image, lot number and protocol we used for keratinocyte using anti-FZD3 antibody A04680-1. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-12-16

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-12-16

Question

I see that the anti-FZD3 antibody A04680-1 works with WB, what is the protocol used to produce the result images on the product page?

H. Moore

Verified customer

Asked: 2019-12-03

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-12-03

Question

I was wanting to use your anti-FZD3 antibody for WB for rat keratinocyte on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for rat keratinocyte identification?

Verified Customer

Verified customer

Asked: 2019-11-15

Answer

It shows on the product datasheet, A04680-1 anti-FZD3 antibody has been tested for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat keratinocyte in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-11-15

Question

Would A04680-1 anti-FZD3 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

A. Williams

Verified customer

Asked: 2019-11-14

Answer

You can see on the product datasheet, A04680-1 anti-FZD3 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-11-14

Question

My question regarding product A04680-1, anti-FZD3 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

J. Banerjee

Verified customer

Asked: 2018-09-27

Answer

We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A04680-1 anti-FZD3 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2018-09-27

Question

Our lab want to know about to test anti-FZD3 antibody A04680-1 on rat keratinocyte for research purposes, then I may be interested in using anti-FZD3 antibody A04680-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2018-06-28

Answer

The products we sell, including anti-FZD3 antibody A04680-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2018-06-28

Question

Is a blocking peptide available for product anti-FZD3 antibody (A04680-1)?

J. Johnson

Verified customer

Asked: 2018-03-13

Answer

We do provide the blocking peptide for product anti-FZD3 antibody (A04680-1). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2018-03-13

Question

Do you have a BSA free version of anti-FZD3 antibody A04680-1 available?

Verified Customer

Verified customer

Asked: 2017-11-14

Answer

Thanks for your recent telephone inquiry. I can confirm that some lots of this anti-FZD3 antibody A04680-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2017-11-14

Question

We are currently using anti-FZD3 antibody A04680-1 for mouse tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on feline tissues as well?

N. Mangal

Verified customer

Asked: 2017-04-20

Answer

The anti-FZD3 antibody (A04680-1) has not been validated for cross reactivity specifically with feline tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2017-04-20

Question

Does anti-FZD3 antibody A04680-1 work on bovine WB with brain?

R. Krishna

Verified customer

Asked: 2014-11-24

Answer

Our lab technicians have not tested anti-FZD3 antibody A04680-1 on bovine. You can run a BLAST between bovine and the immunogen sequence of anti-FZD3 antibody A04680-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated bovine samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in bovine brain in WB, you can get your next antibody for free.

Boster Scientific Support

Answered: 2014-11-24

Question

I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for keratinocyte using anti-FZD3 antibody A04680-1. Let me know if you need anything else.

R. Edwards

Verified customer

Asked: 2013-02-22

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2013-02-22

Order DetailsPrice
A04680-1

100μg

$370
A04680-1-10ug

10μg sample (liquid)

$99
A04680-1-Biotin

100 μg Biotin conjugated

$570
A04680-1-Cy3

100 μg Cy3 conjugated

$570
A04680-1-Dylight488

100 μg Dylight488 conjugated

$570
A04680-1-Dylight550

100 μg Dylight550 conjugated

$570
A04680-1-Dylight594

100 μg Dylight594 conjugated

$570
A04680-1-FITC

100 μg FITC conjugated

$570
A04680-1-HRP

100 μg HRP conjugated

$570
A04680-1-APC

100 μg APC conjugated

$670
A04680-1-PE

100 μg PE conjugated

$670
A04680-1-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A04680-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.