Anti-HOXB1 Antibody Picoband™

HOXB1 antibody

Boster Bio Anti-HOXB1 Antibody Picoband™ catalog # A04724-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A04724-1
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: WB

Product Name

Anti-HOXB1 Antibody Picoband™

View all HOXB1 Antibodies

SKU/Catalog Number

A04724-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-HOXB1 Antibody Picoband™ catalog # A04724-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-HOXB1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A04724-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human HOXB1, different from the related mouse sequence by four amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A04724-1 is reactive to HOXB1 in Human, Mouse, Rat

Applications

A04724-1 is guaranteed for WB Boster Guarantee

Observed Molecular Weight

32 kDa

Calculated molecular weight

32.193kDa

Background of HOXB1

Homeobox protein Hox-B1 is a protein that in humans is encoded by the HOXB1 gene. This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXB genes located in a cluster on chromosome 17.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat

Validation Images & Assay Conditions

Gene/Protein Information For HOXB1 (Source: Uniprot.org, NCBI)

Gene Name

HOXB1

Full Name

Homeobox protein Hox-B1

Weight

32.193kDa

Superfamily

Antp homeobox family

Alternative Names

homeo box 2I; homeo box B1; homeobox B1; Homeobox protein Hox-2I; homeobox protein Hox-B1; HOX2; Hox-2.9; HOX2I; HOX2IMGC116844; HOXB1; MGC116843; MGC116845 HOXB1 HCFP3, HOX2, HOX2I, Hox-2.9 homeobox B1 homeobox protein Hox-B1|homeobox protein Hox-2I

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on HOXB1, check out the HOXB1 Infographic

HOXB1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HOXB1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A04724-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-HOXB1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review Anti-HOXB1 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

13 Customer Q&As for Anti-HOXB1 Antibody Picoband™

Question

Will A04724-1 anti-HOXB1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2020-05-04

Answer

As indicated on the product datasheet, A04724-1 anti-HOXB1 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2020-05-04

Question

Is there a BSA free version of anti-HOXB1 antibody A04724-1 available?

Verified Customer

Verified customer

Asked: 2020-04-30

Answer

I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-HOXB1 antibody A04724-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2020-04-30

Question

I was wanting to use your anti-HOXB1 antibody for WB for mouse skeletal muscle tissue on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse skeletal muscle tissue identification?

Verified Customer

Verified customer

Asked: 2019-12-25

Answer

As indicated on the product datasheet, A04724-1 anti-HOXB1 antibody has been validated for WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse skeletal muscle tissue in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-12-25

Question

Is this A04724-1 anti-HOXB1 antibody reactive to the isotypes of HOXB1?

Verified Customer

Verified customer

Asked: 2019-12-11

Answer

The immunogen of A04724-1 anti-HOXB1 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human HOXB1 (176-220aa TARTFDWMKVKRNPPKTAKVSEPGLGSPSGLRTNFTTRQLTELEK), different from the related mouse sequence by four amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-12-11

Question

We are currently using anti-HOXB1 antibody A04724-1 for mouse tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on monkey tissues as well?

R. Jha

Verified customer

Asked: 2019-11-11

Answer

The anti-HOXB1 antibody (A04724-1) has not been validated for cross reactivity specifically with monkey tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-11-11

Question

Can you help my question with product A04724-1, anti-HOXB1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-11-07

Answer

We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A04724-1 anti-HOXB1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-11-07

Question

Is a blocking peptide available for product anti-HOXB1 antibody (A04724-1)?

Verified Customer

Verified customer

Asked: 2019-10-14

Answer

We do provide the blocking peptide for product anti-HOXB1 antibody (A04724-1). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-10-14

Question

We are interested in to test anti-HOXB1 antibody A04724-1 on mouse skeletal muscle tissue for research purposes, then I may be interested in using anti-HOXB1 antibody A04724-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-07-10

Answer

The products we sell, including anti-HOXB1 antibody A04724-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-07-10

Question

I see that the anti-HOXB1 antibody A04724-1 works with WB, what is the protocol used to produce the result images on the product page?

O. Zhang

Verified customer

Asked: 2019-06-12

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-06-12

Question

Will anti-HOXB1 antibody A04724-1 work on primate WB with skeletal muscle tissue?

Verified Customer

Verified customer

Asked: 2019-04-03

Answer

Our lab technicians have not validated anti-HOXB1 antibody A04724-1 on primate. You can run a BLAST between primate and the immunogen sequence of anti-HOXB1 antibody A04724-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated primate samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in primate skeletal muscle tissue in WB, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-04-03

Question

Please see the WB image, lot number and protocol we used for skeletal muscle tissue using anti-HOXB1 antibody A04724-1. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2018-08-22

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-08-22

Question

Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for skeletal muscle tissue using anti-HOXB1 antibody A04724-1. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2018-08-02

Answer

Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-08-02

Question

Will anti-HOXB1 antibody A04724-1 work for WB with skeletal muscle tissue?

A. Wu

Verified customer

Asked: 2017-01-25

Answer

According to the expression profile of skeletal muscle tissue, HOXB1 is highly expressed in skeletal muscle tissue. So, it is likely that anti-HOXB1 antibody A04724-1 will work for WB with skeletal muscle tissue.

Boster Scientific Support

Answered: 2017-01-25

Order DetailsPrice
A04724-1

100μg

$370
A04724-1-10ug

10μg sample (liquid)

$99
A04724-1-Biotin

100 μg Biotin conjugated

$570
A04724-1-Cy3

100 μg Cy3 conjugated

$570
A04724-1-Dylight488

100 μg Dylight488 conjugated

$570
A04724-1-Dylight550

100 μg Dylight550 conjugated

$570
A04724-1-Dylight594

100 μg Dylight594 conjugated

$570
A04724-1-FITC

100 μg FITC conjugated

$570
A04724-1-HRP

100 μg HRP conjugated

$570
A04724-1-APC

100 μg APC conjugated

$670
A04724-1-PE

100 μg PE conjugated

$670
A04724-1-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A04724-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.