Anti-HTRA1 Antibody Picoband™

HTRA1/PRSS11 antibody

Boster Bio Anti-HTRA1 Antibody Picoband™ catalog # A01801-1. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A01801-1
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC, WB

Customers Who Bought This Also Bought

Product Name

Anti-HTRA1 Antibody Picoband™

View all HTRA1/PRSS11 Antibodies

SKU/Catalog Number

A01801-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-HTRA1 Antibody Picoband™ catalog # A01801-1. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-HTRA1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01801-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human HTRA1, which shares 93.2% amino acid (aa) sequence identity with both mouse and rat HTRA1.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A01801-1 is reactive to HTRA1 in Human, Mouse, Rat

Applications

A01801-1 is guaranteed for IHC, WB Boster Guarantee

Observed Molecular Weight

51 kDa

Calculated molecular weight

51.287kDa

Background of HTRA1/PRSS11

Serine protease HTRA1 is an enzyme that in humans is encoded by the HTRA1 gene. This gene encodes a member of the trypsin family of serine proteases. This protein is a secreted enzyme that is proposed to regulate the availability of insulin-like growth factors (IGFs) by cleaving IGF-binding proteins. It has also been suggested to be a regulator of cell growth. Variations in the promoter region of this gene are the cause of susceptibility to age-related macular degeneration type 7.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml

Validation Images & Assay Conditions

Gene/Protein Information For HTRA1 (Source: Uniprot.org, NCBI)

Gene Name

HTRA1

Full Name

Serine protease HTRA1

Weight

51.287kDa

Superfamily

peptidase S1C family

Alternative Names

ARMD7; EC 3.4.21; EC 3.4.21.108; High-temperature requirement A serine peptidase 1; HtrA serine peptidase 1; HTRA1; IGFBP5-protease; L56; ORF480; PRSS11; Serine protease 11; serine, 11 (IGF binding) HTRA1 ARMD7, CADASIL2, CARASIL, HtrA, L56, ORF480, PRSS11 HtrA serine peptidase 1 serine protease HTRA1|IGFBP5-protease|high-temperature requirement A serine peptidase 1|protease, serine, 11 (IGF binding)

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on HTRA1, check out the HTRA1 Infographic

HTRA1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HTRA1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A01801-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-HTRA1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review Anti-HTRA1 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

5 Customer Q&As for Anti-HTRA1 Antibody Picoband™

Question

Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for placenta using anti-HTRA1 antibody A01801-1. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2020-04-16

Answer

I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-04-16

Question

We are currently using anti-HTRA1 antibody A01801-1 for human tissue, and we are content with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on zebrafish tissues as well?

Verified Customer

Verified customer

Asked: 2020-01-27

Answer

The anti-HTRA1 antibody (A01801-1) has not been validated for cross reactivity specifically with zebrafish tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-01-27

Question

Is this A01801-1 anti-HTRA1 antibody reactive to the isotypes of HTRA1?

E. Zhang

Verified customer

Asked: 2019-11-11

Answer

The immunogen of A01801-1 anti-HTRA1 antibody is A synthetic peptide corresponding to a sequence of human HTRA1 (QLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIAD). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-11-11

Question

I was wanting to use your anti-HTRA1 antibody for WB for rat placenta on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for rat placenta identification?

Verified Customer

Verified customer

Asked: 2019-09-25

Answer

It shows on the product datasheet, A01801-1 anti-HTRA1 antibody has been validated for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat placenta in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-09-25

Question

My question regarding product A01801-1, anti-HTRA1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

B. Miller

Verified customer

Asked: 2018-12-31

Answer

We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A01801-1 anti-HTRA1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2018-12-31

Order DetailsPrice
A01801-1

100μg

$370
A01801-1-10ug

10μg sample (liquid)

$99
A01801-1-Biotin

100 μg Biotin conjugated

$570
A01801-1-Cy3

100 μg Cy3 conjugated

$570
A01801-1-Dylight488

100 μg Dylight488 conjugated

$570
A01801-1-Dylight550

100 μg Dylight550 conjugated

$570
A01801-1-Dylight594

100 μg Dylight594 conjugated

$570
A01801-1-FITC

100 μg FITC conjugated

$570
A01801-1-HRP

100 μg HRP conjugated

$570
A01801-1-APC

100 μg APC conjugated

$670
A01801-1-PE

100 μg PE conjugated

$670
A01801-1-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A01801-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.