Anti-Human POR DyLight® 488 conjugated Antibody

POR/Cytochrome P450 Reductase antibody

Boster Bio Anti-Human POR DyLight® 488 conjugated Antibody catalog # A02166-Dyl488. Tested in Flow Cytometry applications. This antibody reacts with Human.

Product Info Summary

SKU: A02166-Dyl488
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: Flow Cytometry

Customers Who Bought This Also Bought

Product Name

Anti-Human POR DyLight® 488 conjugated Antibody

View all POR/Cytochrome P450 Reductase Antibodies

SKU/Catalog Number

A02166-Dyl488

Size

100 μg/vial

Form

Liquid

Description

Boster Bio Anti-Human POR DyLight® 488 conjugated Antibody catalog # A02166-Dyl488. Tested in Flow Cytometry applications. This antibody reacts with Human.

Storage & Handling

At -20°C for one year from date of receipt. Avoid repeated freezing and thawing. Protect from light.

Cite This Product

Anti-Human POR DyLight® 488 conjugated Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # A02166-Dyl488)

Host

Rabbit

Contents

Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human POR (633-668aa RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK), different from the related mouse and rat sequences by five amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A02166-Dyl488 is reactive to POR in Human

Applications

A02166-Dyl488 is guaranteed for Flow Cytometry Boster Guarantee

Background of POR/Cytochrome P450 Reductase

POR is a membrane-boundenzyme required for electron transfer from NADPH to cytochrome P450 in the endoplasmic reticulum of theeukaryotic cell. The gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Flow Cytometry, 1-3μg/1x106 cells

Validation Images & Assay Conditions

Gene/Protein Information For POR (Source: Uniprot.org, NCBI)

Uniprot ID

P16435

Gene ID

5447

Gene Name

POR

Full Name

NADPH--cytochrome P450 reductase

Weight

76.69kDa

Superfamily

NADPH--cytochrome P450 reductase family

Alternative Names

CPR; CYPOR; CYPORFLJ26468; Cytochrome P450 Reductase; DKFZp686G04235; EC 1.6.2.4; NADPH--cytochrome P450 reductase; NADPH-dependent cytochrome P450 reductase; P450 (cytochrome) oxidoreductase; P450R; POR POR CPR, CYPOR, P450R cytochrome p450 oxidoreductase NADPH--cytochrome P450 reductase|NADPH--hemoprotein reductase|NADPH-dependent cytochrome P450 reductase|P450 (cytochrome) oxidoreductase

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on POR, check out the POR Infographic

POR infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for POR: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected]

No publications found for A02166-Dyl488

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Human POR DyLight® 488 conjugated Antibody?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-Human POR DyLight® 488 conjugated Antibody

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

4 Customer Q&As for Anti-Human POR DyLight® 488 conjugated Antibody

Question

Can you help my question with product A02166-Dyl488, anti-Human POR DyLight® 488 conjugated antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2020-02-13

Answer

We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A02166-Dyl488 anti-Human POR DyLight® 488 conjugated antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2020-02-13

Question

I was wanting to use your anti-Human POR DyLight® 488 conjugated antibody for Flow Cytometry for human right adrenal gland on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human right adrenal gland identification?

Verified Customer

Verified customer

Asked: 2019-05-27

Answer

You can see on the product datasheet, A02166-Dyl488 anti-Human POR DyLight® 488 conjugated antibody has been tested for Flow Cytometry on human tissues. We have an innovator award program that if you test this antibody and show it works in human right adrenal gland in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-05-27

Question

Here is the WB image, lot number and protocol we used for right adrenal gland using anti-Human POR DyLight® 488 conjugated antibody A02166-Dyl488. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2018-04-05

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-04-05

Question

I see that the anti-Human POR DyLight® 488 conjugated antibody A02166-Dyl488 works with Flow Cytometry, what is the protocol used to produce the result images on the product page?

G. Zhao

Verified customer

Asked: 2015-11-09

Answer

You can find protocols for Flow Cytometry on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2015-11-09

Size

Total: $515

SKU:A02166-Dyl488

Ask a question

Get A Quote

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
A02166-Dyl488
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$515.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.