Anti-IFNGR1 Antibody Picoband™

Boster Bio Anti-IFNGR1 Antibody Picoband™ catalog # A01716-1. Tested in Flow Cytometry, IHC, ICC, WB applications. This antibody reacts with Human. Cited in 1 publication(s).

Product Info Summary

SKU: A01716-1
Size: 100μg/vial
Reactive Species: Human
Host: Rabbit
Application: Flow Cytometry, IHC, ICC, WB

Product Name

Anti-IFNGR1 Antibody Picoband™

See all IFN-gamma R1/CD119 products

SKU/Catalog Number

A01716-1

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-IFNGR1 Antibody Picoband™ catalog # A01716-1. Tested in Flow Cytometry, IHC, ICC, WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-IFNGR1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01716-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human IFNGR1 (443-484aa QELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYRPTED), different from the related mouse sequence by seventeen amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A01716-1 is reactive to IFNGR1 in Human

Applications

A01716-1 is guaranteed for Flow Cytometry, IHC, ICC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Immunohistochemistry (Frozen Section), 0.5-1μg/ml
Immunocytochemistry, 0.5-1μg/ml
Western blot, 0.1-0.5μg/ml
Flow Cytometry, 1-3μg/1x106 cells

Validation Images & Assay Conditions

Gene/Protein Information For IFNGR1 (Source: Uniprot.Org, NCBI)

Uniprot ID

P15260

Gene ID

3459

Gene Name

IFNGR1

Full Name

Interferon gamma receptor 1

Weight

54.405kDa

Superfamily

type II cytokine receptor family

Alternative Names

AVP, type 2; CD119 antigen; CD119; FLJ45734; IFN-gamma R1; IFN-gamma receptor 1; IFNgammaR1; IFN-gamma-R1; IFNGR; IFNGR1; IFN-gR1; immune interferon receptor 1; interferon gamma receptor 1; interferon-gamma receptor alpha chain; type 2 IFNGR1 CD119, IFNGR, IMD27A, IMD27B interferon gamma receptor 1 interferon gamma receptor 1|AVP, type 2|CD119 antigen|CDw119|IFN-gamma receptor 1|IFN-gamma-R-alpha|IFN-gamma-R1|antiviral protein, type 2|immune interferon receptor 1|interferon-gamma receptor alpha chain

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on IFNGR1, check out the IFNGR1 Infographic

IFNGR1 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for IFNGR1: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

A01716-1 has been cited in 1 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Death signal transduction induced by co-immobilized TNF-α plus IFN-γ and the development of polymeric anti-cancer drugs
Species: Human

Have you used Anti-IFNGR1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-IFNGR1 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Anti-IFNGR1 Antibody Picoband™

Conjugation

how to order through PO

Size

Total: $315

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
A01716-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$315.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.