Anti-Lyn Antibody Picoband™

LYN antibody

Boster Bio Anti-Lyn Antibody Picoband™ catalog # A01424-2. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A01424-2
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC, WB

Product Name

Anti-Lyn Antibody Picoband™

View all LYN Antibodies

SKU/Catalog Number

A01424-2

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Lyn Antibody Picoband™ catalog # A01424-2. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Lyn Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01424-2)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human Lyn, identical to the related mouse sequence, and different from the related rat sequence by one amino acid.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A01424-2 is reactive to LYN in Human, Mouse, Rat

Applications

A01424-2 is guaranteed for IHC, WB Boster Guarantee

Observed Molecular Weight

59 kDa

Calculated molecular weight

58.574kDa

Background of LYN

Tyrosine-protein kinase Lyn is a protein that in humans is encoded in humans by the LYN gene. It is mapped to 8q12.1. Lyn is a member of the Src family of protein tyrosine kinases. In various hematopoietic cells, Lyn has emerged as a key enzyme involved in the regulation of cell activation.Lyn has been described to have an inhibitory role in myeloid lineage proliferation.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Western blot, 0.1-0.5μg/ml, Human,

Validation Images & Assay Conditions

Gene/Protein Information For LYN (Source: Uniprot.org, NCBI)

Gene Name

LYN

Full Name

Tyrosine-protein kinase Lyn

Weight

58.574kDa

Superfamily

protein kinase superfamily

Alternative Names

EC 2.7.10; EC 2.7.10.2; FLJ26625; Hck-2; JTK8; Lyn; tyrosine-protein kinase Lyn; v-yes-1 Yamaguchi sarcoma viral related oncogene homolog; v-yes-1; Yamaguchi sarcoma viral (v-yes-1) related oncogene homolog LYN JTK8, p53Lyn, p56Lyn LYN proto-oncogene, Src family tyrosine kinase tyrosine-protein kinase Lyn|lck/Yes-related novel protein tyrosine kinase|v-yes-1 Yamaguchi sarcoma viral related oncogene homolog

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on LYN, check out the LYN Infographic

LYN infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for LYN: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A01424-2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Lyn Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review Anti-Lyn Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

16 Customer Q&As for Anti-Lyn Antibody Picoband™

Question

Does A01424-2 anti-Lyn antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2020-04-02

Answer

As indicated on the product datasheet, A01424-2 anti-Lyn antibody as been tested on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2020-04-02

Question

Is this A01424-2 anti-Lyn antibody reactive to the isotypes of LYN?

Verified Customer

Verified customer

Asked: 2020-01-13

Answer

The immunogen of A01424-2 anti-Lyn antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human Lyn (470-501aa DELYDIMKMCWKEKAEERPTFDYLQSVLDDFY), identical to the related mouse sequence, and different from the related rat sequence by one amino acid. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-01-13

Question

Is a blocking peptide available for product anti-Lyn antibody (A01424-2)?

Verified Customer

Verified customer

Asked: 2019-12-09

Answer

We do provide the blocking peptide for product anti-Lyn antibody (A01424-2). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-12-09

Question

Is there a BSA free version of anti-Lyn antibody A01424-2 available?

Verified Customer

Verified customer

Asked: 2019-11-21

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Lyn antibody A01424-2 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-11-21

Question

We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for cervix carcinoma erythroleukemia using anti-Lyn antibody A01424-2. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-09-26

Answer

Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-09-26

Question

We bought anti-Lyn antibody for WB on brain a few years ago. I am using mouse, and We intend to use the antibody for IHC next. I was wanting to use examining brain as well as blood in our next experiment. Could give a recommendation on which antibody would work the best for IHC?

W. Parker

Verified customer

Asked: 2019-02-13

Answer

I took a look at the website and datasheets of our anti-Lyn antibody and I see that A01424-2 has been validated on mouse in both WB and IHC. Thus A01424-2 should work for your application. Our Boster satisfaction guarantee will cover this product for IHC in mouse even if the specific tissue type has not been validated. We do have a comprehensive range of products for IHC detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2019-02-13

Question

Will anti-Lyn antibody A01424-2 work for IHC with cervix carcinoma erythroleukemia?

Verified Customer

Verified customer

Asked: 2019-01-29

Answer

According to the expression profile of cervix carcinoma erythroleukemia, LYN is highly expressed in cervix carcinoma erythroleukemia. So, it is likely that anti-Lyn antibody A01424-2 will work for IHC with cervix carcinoma erythroleukemia.

Boster Scientific Support

Answered: 2019-01-29

Question

I was wanting to use your anti-Lyn antibody for IHC for mouse cervix carcinoma erythroleukemia on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for mouse cervix carcinoma erythroleukemia identification?

Verified Customer

Verified customer

Asked: 2018-07-30

Answer

As indicated on the product datasheet, A01424-2 anti-Lyn antibody has been tested for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse cervix carcinoma erythroleukemia in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2018-07-30

Question

We have observed staining in human liver. Do you have any suggestions? Is anti-Lyn antibody supposed to stain liver positively?

Verified Customer

Verified customer

Asked: 2018-05-01

Answer

From literature liver does express LYN. From Uniprot.org, LYN is expressed in blood, platelet, brain, cervix carcinoma, cervix carcinoma erythroleukemia, liver, among other tissues. Regarding which tissues have LYN expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 11306681
Cervix carcinoma, Pubmed ID: 18669648, 18691976, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Liver, Pubmed ID: 24275569
Platelet, Pubmed ID: 9171348, 18088087

Boster Scientific Support

Answered: 2018-05-01

Question

We are currently using anti-Lyn antibody A01424-2 for mouse tissue, and we are happy with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on goat tissues as well?

D. Li

Verified customer

Asked: 2017-11-29

Answer

The anti-Lyn antibody (A01424-2) has not been tested for cross reactivity specifically with goat tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2017-11-29

Question

See below the WB image, lot number and protocol we used for cervix carcinoma erythroleukemia using anti-Lyn antibody A01424-2. Please let me know if you require anything else.

A. Williams

Verified customer

Asked: 2017-05-15

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2017-05-15

Question

I am looking for to test anti-Lyn antibody A01424-2 on mouse cervix carcinoma erythroleukemia for research purposes, then I may be interested in using anti-Lyn antibody A01424-2 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

O. Parker

Verified customer

Asked: 2017-05-15

Answer

The products we sell, including anti-Lyn antibody A01424-2, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2017-05-15

Question

I see that the anti-Lyn antibody A01424-2 works with IHC, what is the protocol used to produce the result images on the product page?

H. Yang

Verified customer

Asked: 2016-02-23

Answer

You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2016-02-23

Question

We were satisfied with the WB result of your anti-Lyn antibody. However we have seen positive staining in cervix carcinoma erythroleukemia cell membrane. nucleus. cytoplasm. using this antibody. Is that expected? Could you tell me where is LYN supposed to be expressed?

A. Miller

Verified customer

Asked: 2014-03-03

Answer

According to literature, cervix carcinoma erythroleukemia does express LYN. Generally LYN expresses in cell membrane. nucleus. cytoplasm. Regarding which tissues have LYN expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 11306681
Cervix carcinoma, Pubmed ID: 18669648, 18691976, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Liver, Pubmed ID: 24275569
Platelet, Pubmed ID: 9171348, 18088087

Boster Scientific Support

Answered: 2014-03-03

Question

I am interested in using your anti-Lyn antibody for response to toxic substance studies. Has this antibody been tested with western blotting on human tonsil tissue? We would like to see some validation images before ordering.

S. Banerjee

Verified customer

Asked: 2014-02-19

Answer

Thanks for your inquiry. This A01424-2 anti-Lyn antibody is tested on mouse spleen tissue, intestine tissue, rat lymphaden tissue, human tonsil tissue, 293t whole cell lysate. It is guaranteed to work for IHC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2014-02-19

Question

Can you help my question with product A01424-2, anti-Lyn antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

L. Carter

Verified customer

Asked: 2013-05-28

Answer

We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A01424-2 anti-Lyn antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2013-05-28

Order DetailsPrice
A01424-2

100μg

$370
A01424-2-10ug

10μg sample (liquid)

$99
A01424-2-Biotin

100 μg Biotin conjugated

$570
A01424-2-Cy3

100 μg Cy3 conjugated

$570
A01424-2-Dylight488

100 μg Dylight488 conjugated

$570
A01424-2-Dylight550

100 μg Dylight550 conjugated

$570
A01424-2-Dylight594

100 μg Dylight594 conjugated

$570
A01424-2-FITC

100 μg FITC conjugated

$570
A01424-2-HRP

100 μg HRP conjugated

$570
A01424-2-APC

100 μg APC conjugated

$670
A01424-2-PE

100 μg PE conjugated

$670
A01424-2-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A01424-2
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.