Product Info Summary
SKU: | A01262-1 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Melanoma gp100/PMEL Antibody Picoband™
View all PMEL17/SILV Antibodies
SKU/Catalog Number
A01262-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Melanoma gp100/PMEL Antibody Picoband™ catalog # A01262-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Melanoma gp100/PMEL Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01262-1)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Melanoma gp100/PMEL, which shares 71.4% and 65.7% amino acid (aa) sequence identity with mouse and rat Melanoma gp100/PMEL, respectively.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A01262-1 is reactive to PMEL in Human, Mouse, Rat
Applications
A01262-1 is guaranteed for WB Boster Guarantee
Observed Molecular Weight
70 kDa
Calculated molecular weight
70.255kDa
Background of PMEL17/SILV
This gene is mapped to 12q13.2. It encodes a melanocyte-specific type I transmembrane glycoprotein. The encoded protein is enriched in melanosomes, which are the melanin-producing organelles in melanocytes, and plays an essential role in the structural organization of premelanosomes. This protein is involved in generating internal matrix fibers that define the transition from Stage I to Stage II melanosomes. This protein undergoes a complex pattern of prosttranslational processing and modification that is essential to the proper functioning of the protein. A secreted form of this protein that is released by proteolytic ectodomain shedding may be used as a melanoma-specific serum marker. Alternate splicing results in multiple transcript variants.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of Melanoma gp100 using anti-Melanoma gp100 antibody (A01262-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat heart tissue lysate,
Lane 2: mouse heart tissue lysate.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Melanoma gp100 antigen affinity purified polyclonal antibody (Catalog # A01262-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Melanoma gp100 at approximately 70KD. The expected band size for Melanoma gp100 is at 70KD.
Protein Target Info & Infographic
Gene/Protein Information For PMEL (Source: Uniprot.org, NCBI)
Gene Name
PMEL
Full Name
Melanocyte protein PMEL
Weight
70.255kDa
Superfamily
PMEL/NMB family
Alternative Names
D12S53EP1; gp100; ME20; ME20-M; melanocyte protein mel 17; Melanocyte protein Pmel 17; Melanocytes lineage-specific antigen GP100; Melanoma-associated ME20 antigen; melanosomal matrix protein17; PMEL17P100; premelanosome proteinME20M; SI; SIL; silver (mouse homolog) like; silver homolog (mouse); Silver locus protein homolog; silver, mouse, homolog of; SILVPmel17 PMEL D12S53E, ME20, ME20-M, ME20M, P1, P10017, SI, SIL, SILV, gp100, PMEL premelanosome protein melanocyte protein PMEL|melanocyte protein Pmel 17|melanocyte protein mel 17|melanocytes lineage-specific antigen GP100|melanoma-associated ME20 antigen|melanosomal matrix protein17|silver locus protein homolog|silver, mouse, homolog of
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on PMEL, check out the PMEL Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for PMEL: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Melanoma gp100/PMEL Antibody Picoband™ (A01262-1)
Hello CJ!
No publications found for A01262-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Melanoma gp100/PMEL Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
Be the first to review Anti-Melanoma gp100/PMEL Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
15 Customer Q&As for Anti-Melanoma gp100/PMEL Antibody Picoband™
Question
Would anti-Melanoma gp100/PMEL antibody A01262-1 work for WB with melanoma?
Verified Customer
Verified customer
Asked: 2020-03-18
Answer
According to the expression profile of melanoma, PMEL is highly expressed in melanoma. So, it is likely that anti-Melanoma gp100/PMEL antibody A01262-1 will work for WB with melanoma.
Boster Scientific Support
Answered: 2020-03-18
Question
Do you have a BSA free version of anti-Melanoma gp100/PMEL antibody A01262-1 available?
Verified Customer
Verified customer
Asked: 2020-02-19
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Melanoma gp100/PMEL antibody A01262-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2020-02-19
Question
Does A01262-1 anti-Melanoma gp100/PMEL antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2020-02-18
Answer
You can see on the product datasheet, A01262-1 anti-Melanoma gp100/PMEL antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2020-02-18
Question
We have seen staining in human pigmented layer of retina. Any tips? Is anti-Melanoma gp100/PMEL antibody supposed to stain pigmented layer of retina positively?
Verified Customer
Verified customer
Asked: 2020-01-31
Answer
Based on literature pigmented layer of retina does express PMEL. Based on Uniprot.org, PMEL is expressed in pigmented layer of retina, placenta spleen, placenta, melanoma, among other tissues. Regarding which tissues have PMEL expression, here are a few articles citing expression in various tissues:
Melanoma, Pubmed ID: 12643545, 17081065
Placenta, Pubmed ID: 15489334
Placenta, and Spleen, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2020-01-31
Question
We are currently using anti-Melanoma gp100/PMEL antibody A01262-1 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on zebrafish tissues as well?
Verified Customer
Verified customer
Asked: 2019-12-26
Answer
The anti-Melanoma gp100/PMEL antibody (A01262-1) has not been validated for cross reactivity specifically with zebrafish tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-12-26
Question
Is a blocking peptide available for product anti-Melanoma gp100/PMEL antibody (A01262-1)?
Verified Customer
Verified customer
Asked: 2019-12-18
Answer
We do provide the blocking peptide for product anti-Melanoma gp100/PMEL antibody (A01262-1). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-12-18
Question
Can you help my question with product A01262-1, anti-Melanoma gp100/PMEL antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-12-11
Answer
We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A01262-1 anti-Melanoma gp100/PMEL antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-12-11
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for melanoma using anti-Melanoma gp100/PMEL antibody A01262-1. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2019-06-27
Answer
I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-06-27
Question
I see that the anti-Melanoma gp100/PMEL antibody A01262-1 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2019-06-17
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-06-17
Question
We want to test anti-Melanoma gp100/PMEL antibody A01262-1 on rat melanoma for research purposes, then I may be interested in using anti-Melanoma gp100/PMEL antibody A01262-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-05-17
Answer
The products we sell, including anti-Melanoma gp100/PMEL antibody A01262-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-05-17
Question
We need using your anti-Melanoma gp100/PMEL antibody for melanin biosynthetic process studies. Has this antibody been tested with western blotting on rat heart tissue? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2019-05-17
Answer
We appreciate your inquiry. This A01262-1 anti-Melanoma gp100/PMEL antibody is tested on rat heart tissue, tissue lysate, mouse heart tissue. It is guaranteed to work for WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2019-05-17
Question
I was wanting to use your anti-Melanoma gp100/PMEL antibody for WB for rat melanoma on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for rat melanoma identification?
A. Parker
Verified customer
Asked: 2017-01-09
Answer
As indicated on the product datasheet, A01262-1 anti-Melanoma gp100/PMEL antibody has been tested for WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat melanoma in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2017-01-09
Question
Please see the WB image, lot number and protocol we used for melanoma using anti-Melanoma gp100/PMEL antibody A01262-1. Please let me know if you require anything else.
P. Carter
Verified customer
Asked: 2015-12-23
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2015-12-23
Question
Is this A01262-1 anti-Melanoma gp100/PMEL antibody reactive to the isotypes of PMEL?
S. Parker
Verified customer
Asked: 2014-09-26
Answer
The immunogen of A01262-1 anti-Melanoma gp100/PMEL antibody is A synthetic peptide corresponding to a sequence of human Melanoma gp100/PMEL (KVPRNQDWLGVSRQLRTKAWNRQLYPEWTEAQRLD). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2014-09-26
Question
We were well pleased with the WB result of your anti-Melanoma gp100/PMEL antibody. However we have been able to see positive staining in placenta spleen endoplasmic reticulum membrane using this antibody. Is that expected? Could you tell me where is PMEL supposed to be expressed?
S. Collins
Verified customer
Asked: 2013-03-06
Answer
From literature, placenta spleen does express PMEL. Generally PMEL expresses in endoplasmic reticulum membrane. Regarding which tissues have PMEL expression, here are a few articles citing expression in various tissues:
Melanoma, Pubmed ID: 12643545, 17081065
Placenta, Pubmed ID: 15489334
Placenta, and Spleen, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2013-03-06