Anti-Musashi 1/Msi1 Antibody Picoband®

Musashi-1 antibody

Boster Bio Anti-Musashi 1/Msi1 Antibody Picoband® catalog # A05052-1. Tested in IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Product Info Summary

SKU: A05052-1
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IF, IHC, ICC, WB

Product Name

Anti-Musashi 1/Msi1 Antibody Picoband®

View all Musashi-1 Antibodies

SKU/Catalog Number

A05052-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Musashi 1/Msi1 Antibody Picoband® catalog # A05052-1. Tested in IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Musashi 1/Msi1 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A05052-1)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.01mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human Musashi 1/Msi1, identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

A05052-1 is reactive to MSI1 in Human, Mouse, Rat

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Observed Molecular Weight

39 kDa

Calculated molecular weight

39125 MW

Background of Musashi-1

RNA-binding protein Musashi homolog 1 is a protein that in humans is encoded by the MSI1 gene. This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas. A pseudogene for this gene is located on chromosome 11q13.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A05052-1 is guaranteed for IF, IHC, ICC, WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Immunocytochemistry/Immunofluorescence, 5 μg/ml, Human

Positive Control

WB: human 293T whole cell, human T-47D whole cell, human Colo320 whole cell, rat brain tissue, mouse brain tissue
IHC: mouse intestine tissue, rat intestine tissue, rat brain tissue, human lung cancer tissue, human mammary cancer tissue
ICC/IF: MCF7 cell
FCM: CACO-2 cell

Validation Images & Assay Conditions

Gene/Protein Information For MSI1 (Source: Uniprot.org, NCBI)

Gene Name

MSI1

Full Name

RNA-binding protein Musashi homolog 1

Weight

39125 MW

Superfamily

Musashi family

Alternative Names

RNA-binding protein Musashi homolog 1;Musashi-1;MSI1; MSI1 musashi RNA binding protein 1 RNA-binding protein Musashi homolog 1|musashi-1|musashi1

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on MSI1, check out the MSI1 Infographic

MSI1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MSI1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A05052-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Musashi 1/Msi1 Antibody Picoband®?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-Musashi 1/Msi1 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

12 Customer Q&As for Anti-Musashi 1/Msi1 Antibody Picoband®

Question

We are interested in to test anti-Musashi 1/Msi1 antibody A05052-1 on mouse fetal brain for research purposes, then I may be interested in using anti-Musashi 1/Msi1 antibody A05052-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2020-03-30

Answer

The products we sell, including anti-Musashi 1/Msi1 antibody A05052-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2020-03-30

Question

Would anti-Musashi 1/Msi1 antibody A05052-1 work on goat IHC with fetal brain?

Verified Customer

Verified customer

Asked: 2020-03-16

Answer

Our lab technicians have not validated anti-Musashi 1/Msi1 antibody A05052-1 on goat. You can run a BLAST between goat and the immunogen sequence of anti-Musashi 1/Msi1 antibody A05052-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated goat samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in goat fetal brain in IHC, you can get your next antibody for free.

Boster Scientific Support

Answered: 2020-03-16

Question

I see that the anti-Musashi 1/Msi1 antibody A05052-1 works with WB, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2020-02-13

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2020-02-13

Question

We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for fetal brain using anti-Musashi 1/Msi1 antibody A05052-1. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-09-10

Answer

Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-09-10

Question

Is this A05052-1 anti-Musashi 1/Msi1 antibody reactive to the isotypes of MSI1?

Verified Customer

Verified customer

Asked: 2019-07-05

Answer

The immunogen of A05052-1 anti-Musashi 1/Msi1 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human Musashi 1/Msi1 (21-54aa KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-07-05

Question

See below the WB image, lot number and protocol we used for fetal brain using anti-Musashi 1/Msi1 antibody A05052-1. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-05-24

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-05-24

Question

Would A05052-1 anti-Musashi 1/Msi1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2018-07-13

Answer

As indicated on the product datasheet, A05052-1 anti-Musashi 1/Msi1 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2018-07-13

Question

Do you have a BSA free version of anti-Musashi 1/Msi1 antibody A05052-1 available?

S. Parker

Verified customer

Asked: 2018-06-05

Answer

Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-Musashi 1/Msi1 antibody A05052-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2018-06-05

Question

Will anti-Musashi 1/Msi1 antibody A05052-1 work for WB with fetal brain?

Verified Customer

Verified customer

Asked: 2017-06-19

Answer

According to the expression profile of fetal brain, MSI1 is highly expressed in fetal brain. So, it is likely that anti-Musashi 1/Msi1 antibody A05052-1 will work for WB with fetal brain.

Boster Scientific Support

Answered: 2017-06-19

Question

I was wanting to use your anti-Musashi 1/Msi1 antibody for WB for mouse fetal brain on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse fetal brain identification?

Verified Customer

Verified customer

Asked: 2017-06-08

Answer

As indicated on the product datasheet, A05052-1 anti-Musashi 1/Msi1 antibody has been validated for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse fetal brain in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2017-06-08

Question

I have a question about product A05052-1, anti-Musashi 1/Msi1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

D. Krishna

Verified customer

Asked: 2016-06-03

Answer

We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A05052-1 anti-Musashi 1/Msi1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2016-06-03

Question

Is a blocking peptide available for product anti-Musashi 1/Msi1 antibody (A05052-1)?

S. Jones

Verified customer

Asked: 2015-05-29

Answer

We do provide the blocking peptide for product anti-Musashi 1/Msi1 antibody (A05052-1). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2015-05-29

Order DetailsPrice
A05052-1

100μg

$370
A05052-1-10ug

10μg sample (liquid)

$99
A05052-1-Biotin

100 μg Biotin conjugated

$570
A05052-1-Cy3

100 μg Cy3 conjugated

$570
A05052-1-Dylight488

100 μg Dylight488 conjugated

$570
A05052-1-Dylight550

100 μg Dylight550 conjugated

$570
A05052-1-Dylight594

100 μg Dylight594 conjugated

$570
A05052-1-FITC

100 μg FITC conjugated

$570
A05052-1-HRP

100 μg HRP conjugated

$570
A05052-1-APC

100 μg APC conjugated

$670
A05052-1-PE

100 μg PE conjugated

$670
A05052-1-iFluor647

100 μg iFluor647 conjugated

$670
A05052-1-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A05052-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.