Product Info Summary
| SKU: | PB9296 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Neuropeptide Y/NPY Antibody Picoband®
SKU/Catalog Number
PB9296
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Neuropeptide Y/NPY Antibody Picoband® catalog # PB9296. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Neuropeptide Y/NPY Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9296)
Host
Rabbit
Contents
Each vial contains antibody formulated with stabilizing components, 0.9 mg NaCl, 0.2 mg Na2HPO4, and 0.05 mg NaN3.
*This antibody is supplied in a stabilized formulation.
Compatibility with conjugation reactions depends on the chemistry of the conjugation method used.
For conjugation methods that are not compatible with the stabilizing components present in this formulation, a carrier-free antibody format is required.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human Neuropeptide Y, identical to the related mouse and rat sequences.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9296 is reactive to NPY in Human, Mouse, Rat
Observed Molecular Weight
11 kDa
Calculated molecular weight
10.9 kDa
Background of NPY
This gene encodes a neuropeptide that is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function. The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase (MAPK), regulate intracellular calcium levels, and activate potassium channels. A polymorphism in this gene resulting in a change of leucine 7 to proline in the signal peptide is associated with elevated cholesterol levels, higher alcohol consumption, and may be a risk factor for various metabolic and cardiovascular diseases. The protein also exhibits antimicrobial activity against bacteria and fungi.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9296 is guaranteed for IHC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Mouse, Rat, Human
Western blot, 0.1-0.5μg/ml, Human
Positive Control
IHC: human brain tissue, Mouse Brain Tissue, Rat Brain Tissue
Validation Images & Assay Conditions
Click image to see more details
All lanes: Anti Neuropeptide Y (PB9296) at 0.5ug/ml
WB: Recombinant Human Neuropeptide Y Protein 0.5ng
Predicted bind size: 11KD
Observed bind size: 11KD
Click image to see more details
IHC analysis of Neuropeptide Y/NPY using anti-Neuropeptide Y/NPY antibody (PB9296).
Neuropeptide Y/NPY was detected in a paraffin-embedded section of human liver tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-Neuropeptide Y/NPY Antibody (PB9296) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit (Catalog # SV0002) with DAB as the chromogen.
Click image to see more details
IHC analysis of Neuropeptide Y using anti-Neuropeptide Y antibody (PB9296).
Neuropeptide Y was detected in a paraffin-embedded section of human brain tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-Neuropeptide Y Antibody (PB9296) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit (Catalog # SV0002) with DAB as the chromogen.
Click image to see more details
IHC analysis of Neuropeptide Y using anti-Neuropeptide Y antibody (PB9296).
Neuropeptide Y was detected in a paraffin-embedded section of mouse brain tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-Neuropeptide Y Antibody (PB9296) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit (Catalog # SV0002) with DAB as the chromogen.
Click image to see more details
IHC analysis of Neuropeptide Y using anti-Neuropeptide Y antibody (PB9296).
Neuropeptide Y was detected in a paraffin-embedded section of rat brain tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-Neuropeptide Y Antibody (PB9296) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit (Catalog # SV0002) with DAB as the chromogen.
Specific Publications For Anti-Neuropeptide Y/NPY Antibody Picoband® (PB9296)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Neuropeptide Y/NPY Antibody Picoband®?
Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.
0 Reviews For Anti-Neuropeptide Y/NPY Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
17 Customer Q&As for Anti-Neuropeptide Y/NPY Antibody Picoband®
Question
Do you ship PB9296 with dry ice?
Verified customer
Asked: 2022-05-16
Answer
The Anti-Neuropeptide Y/NPY Antibody Picoband™ (PB9296) does not require dry ice during shipping.
Boster Scientific Support
Answered: 2022-05-16
Question
Would anti-Neuropeptide Y/NPY antibody PB9296 work for IHC with prostate gland?
Verified Customer
Verified customer
Asked: 2019-12-10
Answer
According to the expression profile of prostate gland, NPY is highly expressed in prostate gland. So, it is likely that anti-Neuropeptide Y/NPY antibody PB9296 will work for IHC with prostate gland.
Boster Scientific Support
Answered: 2019-12-10
Question
Can you help my question with product PB9296, anti-Neuropeptide Y/NPY antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-08-09
Answer
We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9296 anti-Neuropeptide Y/NPY antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-08-09
Question
Is a blocking peptide available for product anti-Neuropeptide Y/NPY antibody (PB9296)?
Verified Customer
Verified customer
Asked: 2019-07-18
Answer
We do provide the blocking peptide for product anti-Neuropeptide Y/NPY antibody (PB9296). If you would like to place an order for it please contact support@bosterbio.com and make a special request.
Boster Scientific Support
Answered: 2019-07-18
Question
We have observed staining in human prostate gland. Any tips? Is anti-Neuropeptide Y/NPY antibody supposed to stain prostate gland positively?
Verified Customer
Verified customer
Asked: 2019-07-11
Answer
According to literature prostate gland does express NPY. According to Uniprot.org, NPY is expressed in prostate gland, brain, liver, among other tissues. Regarding which tissues have NPY expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 15489334
Liver, Pubmed ID: 24275569
Boster Scientific Support
Answered: 2019-07-11
Question
My lab would like to test anti-Neuropeptide Y/NPY antibody PB9296 on human prostate gland for research purposes, then I may be interested in using anti-Neuropeptide Y/NPY antibody PB9296 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-06-21
Answer
The products we sell, including anti-Neuropeptide Y/NPY antibody PB9296, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-06-21
Question
We are currently using anti-Neuropeptide Y/NPY antibody PB9296 for human tissue, and we are content with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on goat tissues as well?
Verified Customer
Verified customer
Asked: 2019-06-06
Answer
The anti-Neuropeptide Y/NPY antibody (PB9296) has not been validated for cross reactivity specifically with goat tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-06-06
Question
Is there a BSA free version of anti-Neuropeptide Y/NPY antibody PB9296 available?
Verified Customer
Verified customer
Asked: 2019-02-01
Answer
I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Neuropeptide Y/NPY antibody PB9296 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2019-02-01
Question
Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for prostate gland using anti-Neuropeptide Y/NPY antibody PB9296. Let me know if you need anything else.
G. Li
Verified customer
Asked: 2018-07-03
Answer
I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2018-07-03
Question
I see that the anti-Neuropeptide Y/NPY antibody PB9296 works with IHC, what is the protocol used to produce the result images on the product page?
E. Collins
Verified customer
Asked: 2018-04-17
Answer
You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to support@bosterbio.com
Boster Scientific Support
Answered: 2018-04-17
Question
Our lab want to know about using your anti-Neuropeptide Y/NPY antibody for g protein-coupled receptor signaling pathway studies. Has this antibody been tested with western blotting on rat brain tissue? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2017-07-26
Answer
We appreciate your inquiry. This PB9296 anti-Neuropeptide Y/NPY antibody is tested on mouse brain, brain tissue, rat brain tissue. It is guaranteed to work for IHC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2017-07-26
Question
Our lab were well pleased with the WB result of your anti-Neuropeptide Y/NPY antibody. However we have seen positive staining in liver secreted. using this antibody. Is that expected? Could you tell me where is NPY supposed to be expressed?
Verified Customer
Verified customer
Asked: 2017-06-21
Answer
From what I have seen in literature, liver does express NPY. Generally NPY expresses in secreted. Regarding which tissues have NPY expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 15489334
Liver, Pubmed ID: 24275569
Boster Scientific Support
Answered: 2017-06-21
Question
See below the WB image, lot number and protocol we used for prostate gland using anti-Neuropeptide Y/NPY antibody PB9296. Please let me know if you require anything else.
C. Moore
Verified customer
Asked: 2016-05-12
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2016-05-12
Question
We ordered your anti-Neuropeptide Y/NPY antibody for WB on liver in the past. I am using rat, and We want to use the antibody for IHC next. I would like examining liver as well as brain in our next experiment. Do you have any suggestion on which antibody would work the best for IHC?
C. Krishna
Verified customer
Asked: 2015-01-28
Answer
I looked at the website and datasheets of our anti-Neuropeptide Y/NPY antibody and it appears that PB9296 has been tested on rat in both WB and IHC. Thus PB9296 should work for your application. Our Boster satisfaction guarantee will cover this product for IHC in rat even if the specific tissue type has not been validated. We do have a comprehensive range of products for IHC detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2015-01-28
Question
Is this PB9296 anti-Neuropeptide Y/NPY antibody reactive to the isotypes of NPY?
B. Mangal
Verified customer
Asked: 2014-11-07
Answer
The immunogen of PB9296 anti-Neuropeptide Y/NPY antibody is A synthetic peptide corresponding to a sequence in the middle region of human Neuropeptide Y (29-64aa YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2014-11-07
Question
I was wanting to use your anti-Neuropeptide Y/NPY antibody for IHC for human prostate gland on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human prostate gland identification?
C. Jones
Verified customer
Asked: 2014-05-20
Answer
As indicated on the product datasheet, PB9296 anti-Neuropeptide Y/NPY antibody has been validated for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human prostate gland in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2014-05-20
Question
Would PB9296 anti-Neuropeptide Y/NPY antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
E. Dhar
Verified customer
Asked: 2013-10-23
Answer
As indicated on the product datasheet, PB9296 anti-Neuropeptide Y/NPY antibody as been validated on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2013-10-23


