Anti-PC4/SUB1 Antibody Picoband™

SUB1 antibody

Boster Bio Anti-PC4/SUB1 Antibody Picoband™ catalog # PB10098. Tested in IF, IHC WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: PB10098
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IF, IHC, WB

Product Name

Anti-PC4/SUB1 Antibody Picoband™

View all SUB1 Antibodies

SKU/Catalog Number

PB10098

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-PC4/SUB1 Antibody Picoband™ catalog # PB10098. Tested in IF, IHC WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-PC4/SUB1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB10098)

Host

Rabbit

Contents

Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human PC4, different from the related mouse and rat sequences by one amino acid.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB10098 is reactive to SUB1 in Human, Mouse, Rat

Applications

PB10098 is guaranteed for IF, IHC, WB Boster Guarantee

Observed Molecular Weight

19 kDa

Calculated molecular weight

14.395kDa

Background of SUB1

Activated RNA polymerase II transcriptional coactivator p15, also known as positive cofactor 4 (PC4) or SUB1 homolog, is a protein that in humans is encoded by the SUB1 gene. This gene is mapped to 5p13.3. The transcriptional cofactor PC4 is an ancient single-strand DNA (ssDNA)-binding protein that has a homologue in bacteriophage T5 where it is likely the elusive replicative ssDNA-binding protein. The recombinant PC4 is shown to function identically to the native protein through its interaction with TAFs.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml, Human, By Heat
Immunofluorescence, 5 μg/ml, Human

Validation Images & Assay Conditions

Gene/Protein Information For SUB1 (Source: Uniprot.org, NCBI)

Gene Name

SUB1

Full Name

Activated RNA polymerase II transcriptional coactivator p15

Weight

14.395kDa

Superfamily

transcriptional coactivator PC4 family

Alternative Names

activated RNA polymerase II transcription cofactor 4; activated RNA polymerase II transcriptional coactivator p15; MGC102747; p15; PC4p14P15; Positive cofactor 4; RPO2TC1; SUB1 homolog (S. cerevisiae); SUB1 homolog SUB1 P15, PC4, p14 SUB1 regulator of transcription activated RNA polymerase II transcriptional coactivator p15|SUB1 homolog, transcriptional regulator|activated RNA polymerase II transcription cofactor 4|positive cofactor 4

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on SUB1, check out the SUB1 Infographic

SUB1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SUB1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for PB10098

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-PC4/SUB1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-PC4/SUB1 Antibody Picoband™

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

6 Customer Q&As for Anti-PC4/SUB1 Antibody Picoband™

Question

Does PB10098 anti-PC4/SUB1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2019-12-26

Answer

It shows on the product datasheet, PB10098 anti-PC4/SUB1 antibody as been validated on Flow Cytometry. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-12-26

Question

Is this PB10098 anti-PC4/SUB1 antibody reactive to the isotypes of SUB1?

Verified Customer

Verified customer

Asked: 2019-09-19

Answer

The immunogen of PB10098 anti-PC4/SUB1 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human PC4 (96-127aa MKPGRKGISLNPEQWSQLKEQISDIDDAVRKL), different from the related mouse and rat sequences by one amino acid. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-09-19

Question

Would anti-PC4/SUB1 antibody PB10098 work for Flow Cytometry with cervix carcinoma erythroleukemia?

Verified Customer

Verified customer

Asked: 2019-05-16

Answer

According to the expression profile of cervix carcinoma erythroleukemia, SUB1 is highly expressed in cervix carcinoma erythroleukemia. So, it is likely that anti-PC4/SUB1 antibody PB10098 will work for Flow Cytometry with cervix carcinoma erythroleukemia.

Boster Scientific Support

Answered: 2019-05-16

Question

Is a blocking peptide available for product anti-PC4/SUB1 antibody (PB10098)?

M. Mangal

Verified customer

Asked: 2019-04-24

Answer

We do provide the blocking peptide for product anti-PC4/SUB1 antibody (PB10098). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-04-24

Question

Would anti-PC4/SUB1 antibody PB10098 work on pig WB with cervix carcinoma?

Verified Customer

Verified customer

Asked: 2018-10-09

Answer

Our lab technicians have not tested anti-PC4/SUB1 antibody PB10098 on pig. You can run a BLAST between pig and the immunogen sequence of anti-PC4/SUB1 antibody PB10098 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated pig samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in pig cervix carcinoma in WB, you can get your next antibody for free.

Boster Scientific Support

Answered: 2018-10-09

Question

We are currently using anti-PC4/SUB1 antibody PB10098 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on dog tissues as well?

Verified Customer

Verified customer

Asked: 2018-01-04

Answer

The anti-PC4/SUB1 antibody (PB10098) has not been validated for cross reactivity specifically with dog tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2018-01-04

Order DetailsPrice
PB10098

100μg

$370
PB10098-10ug

10μg sample (liquid)

$99
PB10098-Biotin

100 μg Biotin conjugated

$570
PB10098-Cy3

100 μg Cy3 conjugated

$570
PB10098-Dylight488

100 μg Dylight488 conjugated

$570
PB10098-Dylight550

100 μg Dylight550 conjugated

$570
PB10098-Dylight594

100 μg Dylight594 conjugated

$570
PB10098-FITC

100 μg FITC conjugated

$570
PB10098-HRP

100 μg HRP conjugated

$570
PB10098-APC

100 μg APC conjugated

$670
PB10098-PE

100 μg PE conjugated

$670
PB10098-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB10098
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.