Product Info Summary
SKU: | PB10084 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human |
Host: | Rabbit |
Application: | Flow Cytometry, IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-PML Protein Antibody Picoband™
View all PML Protein Antibodies
SKU/Catalog Number
PB10084
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-PML Protein Antibody Picoband™ catalog # PB10084. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-PML Protein Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB10084)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human PML Protein, different from the related mouse sequence by eight amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB10084 is reactive to PML in Human
Applications
PB10084 is guaranteed for Flow Cytometry, IHC, WB Boster Guarantee
Observed Molecular Weight
90-160 kDa
Calculated molecular weight
97.551kDa
Background of PML Protein
The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Extensive alternative splicing of this gene results in several variations of the protein's central and C-terminal regions; all variants encode the same N-terminus. Alternatively spliced transcript variants encoding different isoforms have been identified.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Flow Cytometry, 1-3μg/1x106 cells, Human
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of PML using anti-PML antibody (PB10084).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human Hela whole cell lysates,
Lane 2: human HEK293 whole cell lysates,
Lane 3: human U87 whole cell lysates,
Lane 4: human A431 whole cell lysates,
Lane 5: human K562 whole cell lysates.
red to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-PML antigen affinity purified polyclonal antibody (Catalog # PB10084) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for PML at approximately 90-160 kDa. The expected band size for PML is at 98 kDa.
Click image to see more details
Figure 2. IHC analysis of PML using anti-PML antibody (PB10084).
PML was detected in paraffin-embedded section of human intestinal cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-PML Antibody (PB10084) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. Flow Cytometry analysis of A431 cells using anti-PML antibody (PB10084).
Overlay histogram showing A431 cells stained with PB10084 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PML Antibody (PB10084,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Click image to see more details
Figure 4. IHC analysis of PML using anti-PML antibody (PB10084).
PML was detected in paraffin-embedded section of human mammary cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-PML Antibody (PB10084) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Protein Target Info & Infographic
Gene/Protein Information For PML (Source: Uniprot.org, NCBI)
Gene Name
PML
Full Name
Protein PML
Weight
97.551kDa
Alternative Names
MYLPP8675; Promyelocytic leukemia protein; promyelocytic leukemia; RING finger protein 71; RNF71probable transcription factor PML; TRIM19promyelocytic leukemia, inducer of; tripartite motif protein TRIM19; Tripartite motif-containing protein 19 PML MYL, PP8675, RNF71, TRIM19 PML nuclear body scaffold protein PML|PML/RARA fusion|RING finger protein 71|probable transcription factor PML|promyelocytic leukemia protein|promyelocytic leukemia, inducer of|tripartite motif protein TRIM19|tripartite motif-containing protein 19
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on PML, check out the PML Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for PML: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-PML Protein Antibody Picoband™ (PB10084)
Hello CJ!
No publications found for PB10084
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-PML Protein Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-PML Protein Antibody Picoband™
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
17 Customer Q&As for Anti-PML Protein Antibody Picoband™
Question
I was wanting to use your anti-PML Protein antibody for WB for human left lobe of thyroid gland on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human left lobe of thyroid gland identification?
Verified Customer
Verified customer
Asked: 2020-04-09
Answer
As indicated on the product datasheet, PB10084 anti-PML Protein antibody has been validated for Flow Cytometry, IHC-P, WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human left lobe of thyroid gland in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2020-04-09
Question
My boss were satisfied with the WB result of your anti-PML Protein antibody. However we have seen positive staining in liver nucleus. nucleus using this antibody. Is that expected? Could you tell me where is PML supposed to be expressed?
Verified Customer
Verified customer
Asked: 2020-01-24
Answer
From what I have seen in literature, liver does express PML. Generally PML expresses in nucleus. nucleus, nucleoplasm. cytoplasm. Regarding which tissues have PML expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 16572171
Cervix carcinoma, Pubmed ID: 17081983, 18669648, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Kidney, Pubmed ID: 15489334
Leukemic T-cell, Pubmed ID: 19690332
Liver, Pubmed ID: 24275569
Boster Scientific Support
Answered: 2020-01-24
Question
We bought anti-PML Protein antibody for Flow Cytometry on brain in the past. I am using human, and We want to use the antibody for WB next. My lab would like examining brain as well as liver in our next experiment. Could you please give me some suggestion on which antibody would work the best for WB?
Verified Customer
Verified customer
Asked: 2020-01-20
Answer
I viewed the website and datasheets of our anti-PML Protein antibody and I see that PB10084 has been validated on human in both Flow Cytometry and WB. Thus PB10084 should work for your application. Our Boster satisfaction guarantee will cover this product for WB in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for WB detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2020-01-20
Question
Can PB10084 be used for IHC-Fr and ICC/IF staining?
Verified customer
Asked: 2019-04-22
Answer
The Anti-PML Protein Antibody Picoband™ (PB10084) has been tested for IHC-F and ICC. The recommended dilutions are: Immunohistochemistry(Frozen Section), 0.5-1μg/ml, Human Immunocytochemistry, 0.5-1μg/ml, Human
Boster Scientific Support
Answered: 2019-04-22
Question
My question regarding product PB10084, anti-PML Protein antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-04-01
Answer
We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB10084 anti-PML Protein antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-04-01
Question
Is this PB10084 anti-PML Protein antibody reactive to the isotypes of PML?
Verified Customer
Verified customer
Asked: 2018-11-14
Answer
The immunogen of PB10084 anti-PML Protein antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human PML Protein (141-179aa FECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLD), different from the related mouse sequence by eight amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2018-11-14
Question
Do you have a BSA free version of anti-PML Protein antibody PB10084 available?
Verified Customer
Verified customer
Asked: 2018-06-26
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-PML Protein antibody PB10084 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2018-06-26
Question
Is a blocking peptide available for product anti-PML Protein antibody (PB10084)?
J. Miller
Verified customer
Asked: 2017-09-06
Answer
We do provide the blocking peptide for product anti-PML Protein antibody (PB10084). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2017-09-06
Question
Does PB10084 anti-PML Protein antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
B. Zhao
Verified customer
Asked: 2017-08-18
Answer
It shows on the product datasheet, PB10084 anti-PML Protein antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2017-08-18
Question
See attached the WB image, lot number and protocol we used for left lobe of thyroid gland using anti-PML Protein antibody PB10084. Please let me know if you require anything else.
M. Johnson
Verified customer
Asked: 2017-07-28
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2017-07-28
Question
Will anti-PML Protein antibody PB10084 work for WB with left lobe of thyroid gland?
W. Carter
Verified customer
Asked: 2015-12-29
Answer
According to the expression profile of left lobe of thyroid gland, PML is highly expressed in left lobe of thyroid gland. So, it is likely that anti-PML Protein antibody PB10084 will work for WB with left lobe of thyroid gland.
Boster Scientific Support
Answered: 2015-12-29
Question
We are currently using anti-PML Protein antibody PB10084 for human tissue, and we are well pleased with the IHC-P results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on primate tissues as well?
M. Lewis
Verified customer
Asked: 2015-06-26
Answer
The anti-PML Protein antibody (PB10084) has not been validated for cross reactivity specifically with primate tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in primate you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2015-06-26
Question
We have been able to see staining in human cervix carcinoma erythroleukemia. Do you have any suggestions? Is anti-PML Protein antibody supposed to stain cervix carcinoma erythroleukemia positively?
M. Zhang
Verified customer
Asked: 2015-05-08
Answer
From what I have seen in literature cervix carcinoma erythroleukemia does express PML. From what I have seen in Uniprot.org, PML is expressed in left lobe of thyroid gland, brain, kidney, cervix carcinoma, leukemic t-cell, cervix carcinoma erythroleukemia, liver, among other tissues. Regarding which tissues have PML expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 16572171
Cervix carcinoma, Pubmed ID: 17081983, 18669648, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Kidney, Pubmed ID: 15489334
Leukemic T-cell, Pubmed ID: 19690332
Liver, Pubmed ID: 24275569
Boster Scientific Support
Answered: 2015-05-08
Question
I see that the anti-PML Protein antibody PB10084 works with WB, what is the protocol used to produce the result images on the product page?
A. Roberts
Verified customer
Asked: 2015-04-24
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2015-04-24
Question
I am interested in to test anti-PML Protein antibody PB10084 on human left lobe of thyroid gland for research purposes, then I may be interested in using anti-PML Protein antibody PB10084 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
A. Anderson
Verified customer
Asked: 2014-12-24
Answer
The products we sell, including anti-PML Protein antibody PB10084, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2014-12-24
Question
I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for left lobe of thyroid gland using anti-PML Protein antibody PB10084. Let me know if you need anything else.
S. Anderson
Verified customer
Asked: 2013-10-28
Answer
We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2013-10-28
Question
I am looking for using your anti-PML Protein antibody for telomeric region studies. Has this antibody been tested with western blotting on sw620 whole cell lysates? We would like to see some validation images before ordering.
G. Singh
Verified customer
Asked: 2013-06-20
Answer
We appreciate your inquiry. This PB10084 anti-PML Protein antibody is validated on sw620 whole cell lysates, u20s whole cell lysates, a431 cells. It is guaranteed to work for Flow Cytometry, IHC-P, WB in human. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2013-06-20