Product Info Summary
SKU: | A00614-1 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human |
Host: | Rabbit |
Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-SRY Antibody Picoband™
SKU/Catalog Number
A00614-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-SRY Antibody Picoband™ catalog # A00614-1. Tested in WB applications. This antibody reacts with Human.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-SRY Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00614-1)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human SRY.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A00614-1 is reactive to SRY in Human
Applications
A00614-1 is guaranteed for WB Boster Guarantee
Observed Molecular Weight
26 kDa
Calculated molecular weight
23.884kDa
Background of SRY
This intronless gene encodes a transcription factor that is a member of the high mobility group (HMG)-box family of DNA-binding proteins. This protein is the testis-determining factor (TDF), which initiates male sex determination. Mutations in this gene give rise to XY females with gonadal dysgenesis (Swyer syndrome); translocation of part of the Y chromosome containing this gene to the X chromosome causes XX male syndrome.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of SRY using anti-SRY antibody (A00614-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human Hela whole cell lysate.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SRY antigen affinity purified polyclonal antibody (Catalog # A00614-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for SRY at approximately 26KD. The expected band size for SRY is at 24KD.
Protein Target Info & Infographic
Gene/Protein Information For SRY (Source: Uniprot.org, NCBI)
Gene Name
SRY
Full Name
Sex-determining region Y protein
Weight
23.884kDa
Superfamily
SRY family
Alternative Names
essential protein for sex determination in human males; sex determining region Y; sex-determining region on Y; sex-determining region Y protein; TDFsex determining region protein; TDY; Testis-determining factor SRY SRXX1, SRXY1, TDF, TDY sex determining region Y sex-determining region Y protein|essential protein for sex determination in human males|sex-determining region on Y|testis-determining factor on Y|truncated sex-determining region Y protein
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on SRY, check out the SRY Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for SRY: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-SRY Antibody Picoband™ (A00614-1)
Hello CJ!
No publications found for A00614-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-SRY Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
Be the first to review Anti-SRY Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
5 Customer Q&As for Anti-SRY Antibody Picoband™
Question
My question regards to test anti-SRY antibody A00614-1 on human skin of abdomen for research purposes, then I may be interested in using anti-SRY antibody A00614-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-11-07
Answer
The products we sell, including anti-SRY antibody A00614-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-11-07
Question
I was wanting to use your anti-SRY antibody for WB for human skin of abdomen on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human skin of abdomen identification?
Verified Customer
Verified customer
Asked: 2019-06-13
Answer
It shows on the product datasheet, A00614-1 anti-SRY antibody has been tested for WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human skin of abdomen in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-06-13
Question
We are currently using anti-SRY antibody A00614-1 for human tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on monkey tissues as well?
Verified Customer
Verified customer
Asked: 2019-05-20
Answer
The anti-SRY antibody (A00614-1) has not been tested for cross reactivity specifically with monkey tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-05-20
Question
Will anti-SRY antibody A00614-1 work for WB with skin of abdomen?
O. Johnson
Verified customer
Asked: 2019-02-06
Answer
According to the expression profile of skin of abdomen, SRY is highly expressed in skin of abdomen. So, it is likely that anti-SRY antibody A00614-1 will work for WB with skin of abdomen.
Boster Scientific Support
Answered: 2019-02-06
Question
Is this A00614-1 anti-SRY antibody reactive to the isotypes of SRY?
J. Miller
Verified customer
Asked: 2013-12-30
Answer
The immunogen of A00614-1 anti-SRY antibody is A synthetic peptide corresponding to a sequence in the middle region of human SRY (90-130aa ISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYR). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2013-12-30