Product Info Summary
| SKU: | PROTP09429-5 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Human |
| Source: | HEK293 cell |
| Application: | Cell Culture |
Product info
Product Name
Human (mammalian cell expression) recombinant HMGB1 C23AC45AC106A protein, AF
View all HMGB1 recombinant proteins
SKU/Catalog Number
PROTP09429-5
Size
5ug,20ug,100ug
Tag
His-SUMO Tag (N-term)
Description
High Mobility Group protein B1 protein (HMGB1) is the high mobility group box family of non-histone chromosomal proteins. Human HMGB1 is expressed as a 25 kDa single chain polypeptide containing three domains: two N-terminal HMG boxes A and B, and a negatively charged 30 a.a. C-terminal region that contains only Asp and Glu. Post-translational modification on HMGB1 have been reported, affect its localization, receptor interactions, and function. HMGB1, with a disulfide bond between C23 and C45 , have been reported that cause cytokine production and the activation of NF-κB. Otherwise, the fully oxidized form has no immune function, losing its proinflammatory effect and the apoptotic cell death activation function. Here, we developed HMGB1 C23A, C45A & 10?A mutant proteins, the fully oxidized HMGB1, eliminant the disulfide bond formation.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human (mammalian cell expression) recombinant HMGB1 C23AC45AC106A protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP09429-5)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
24.9 kDa
Molecular weight
The protein has a calculated MW of 36.33 kDa. The protein migrates as 35-48 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce TNF alpha in RAW264.7 cells. The ED₅₀ for this effect is <10 μg/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MGKGDPKKPRGKMSSYAFFVQTAREEHKKKHPDASVNFSEFSKKASERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFASEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE with polyhistidine-SUMO tag at the N-terminus
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human HMGB1 C23AC45AC10?A
Specific Publications For Human (mammalian cell expression) recombinant HMGB1 C23AC45AC106A protein, AF (PROTP09429-5)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human (mammalian cell expression) recombinant HMGB1 C23AC45AC106A protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human (mammalian cell expression) recombinant HMGB1 C23AC45AC106A protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
