Human (mammalian cell expression) recombinant HMGB1 protein, AF

HMGB1 protein, Human

High mobility group protein B1 protein (HMGB1) is the high mobility group box family of non-histone chromosomal proteins. Human HMGB1 is expressed as a 25 kDa single chain polypeptide containing three domains: two N-terminal HMG boxes A and B, and a negatively charged 30 a.a. C-terminal region that contains only Asp and Glu. Post-translational modification on HMGB1 have been reported, affects its localization, receptor interactions, and function. HMGB1, with a disulfide bond between C23 and C45 , have been reported that cause cytokine production and the activation of NF-κB. Otherwise, the fully oxidized form has no immune function, losing its proinflammatory effect and the apoptotic cell death activation function.

Product Info Summary

SKU: PROTP09429-6
Size: 5ug,20ug,100ug
Origin Species: Human
Source: HEK293 cell
Application: Cell Culture

Product Name

Human (mammalian cell expression) recombinant HMGB1 protein, AF

View all HMGB1 recombinant proteins

SKU/Catalog Number

PROTP09429-6

Size

5ug,20ug,100ug

Tag

His-SUMO Tag (N-term)

Description

High mobility group protein B1 protein (HMGB1) is the high mobility group box family of non-histone chromosomal proteins. Human HMGB1 is expressed as a 25 kDa single chain polypeptide containing three domains: two N-terminal HMG boxes A and B, and a negatively charged 30 a.a. C-terminal region that contains only Asp and Glu. Post-translational modification on HMGB1 have been reported, affects its localization, receptor interactions, and function. HMGB1, with a disulfide bond between C23 and C45 , have been reported that cause cytokine production and the activation of NF-κB. Otherwise, the fully oxidized form has no immune function, losing its proinflammatory effect and the apoptotic cell death activation function.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Human (mammalian cell expression) recombinant HMGB1 protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP09429-6)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Purity

>98% as determined by SDS-PAGE.

Predicted MW

24.9 kDa

Molecular weight

The protein has a calculated MW of 36.42 kDa. The protein migrates as 35-48 kDa under reducing condition (SDS-PAGE analysis).

Activity

Measure by its ability to induce TNF alpha in RAW264.7 cells. The ED₅₀ for this effect is <10 μg/mL.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKD PNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKK KKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE with polyhistidine-SUMO tag at the N-terminus

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Human (mammalian cell expression) recombinant HMGB1 protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Human (mammalian cell expression) recombinant HMGB1 protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Human (mammalian cell expression) recombinant HMGB1 protein, AF

Size

Total: $77.00

SKU:PROTP09429-6

Backordered.

Lead time for this item is typically 3-4 weeks

Get A Quote
In stock
Order Product
PROTP09429-6
$77.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: Jun 1, 2026