Click image to see more details
Product Info Summary
| SKU: | PROTP63158 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Mouse |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Product info
Product Name
Mouse recombinant HMGB1 (High mobility group box 1) protein, AF
View all Hmgb1 recombinant proteins
SKU/Catalog Number
PROTP63158
Size
5ug,20ug,100ug
Tag
His Tag (C-term)
Description
High Mobility Group protein B1 protein (HMGB1) is the high mobility group box family of non-histone chromosomal proteins. Human HMGB1 is expressed as a 25 kDa single chain polypeptide containing three domains: two N-terminal HMG boxes A and B, and a negatively charged 30 a.a. C-terminal region that contains only Asp and Glu. Post-translational modification on HMGB1 have been reported, affects its localization, receptor interactions, and function. HMGB1, with a disulfide bond between C23 and C45 , have been reported that cause cytokine production and the activation of NF-κB. Otherwise, the fully oxidized form has no immune function, losing its proinflammatory effect and the apoptotic cell death activation function.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Mouse recombinant HMGB1 (High mobility group box 1) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP63158)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>95% as determined by SDS-PAGE.
Predicted MW
24.9 kDa
Molecular weight
The protein has a calculated MW of 25.56 kDa. The protein migrates as 25-35 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce TNF alpha in RAW264.7 cells. The ED₅₀ for this effect is <15 ng/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE with polyhistidine tag at the C-terminus
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant mouse HMGB1
Specific Publications For Mouse recombinant HMGB1 (High mobility group box 1) protein, AF (PROTP63158)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Mouse recombinant HMGB1 (High mobility group box 1) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Mouse recombinant HMGB1 (High mobility group box 1) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
