RB1 Retinoblastoma Associated Protein Human Recombinant Protein

Retinoblastoma Human Recombinant fused with 6X His tag produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 146 amino acids and having a molecular mass of 16.5 kDa.
The Retinoblastoma is purified by proprietary chromatographic techniques.

Product Info Summary

SKU: PROTP06400
Size: 10ug, 50ug, 1mg
Origin Species: Mouse
Source: E. Coli
Application: Cell Culture

Customers Who Bought This Also Bought

Product Name

RB1 Retinoblastoma Associated Protein Human Recombinant Protein

See all RB1 products

SKU/Catalog Number

PROTP06400

Size

10ug, 50ug, 1mg

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Description

Retinoblastoma Human Recombinant fused with 6X His tag produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 146 amino acids and having a molecular mass of 16.5 kDa.
The Retinoblastoma is purified by proprietary chromatographic techniques.

Storage & Handling

Lyophilized Retinoblastoma although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Retinoblastoma should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Cite This Product

RB1 Retinoblastoma Associated Protein Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP06400)

Formulation

The RB1 (1 mg/ml) was lyophilized after extensive dialyses against 1xPBS pH-7.4.

Predicted MW

106.159kDa

Amino Acid Sequence

MASFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEKHHHHHH.

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Validation Images & Assay Conditions

Gene/Protein Information For RB1 (Source: Uniprot.Org, NCBI)

Uniprot ID

P06400

Gene ID

5925

Gene Name

RB1

Full Name

Retinoblastoma-associated protein

Weight

106.159kDa

Superfamily

retinoblastoma protein (RB) family

Alternative Names

OSRC; osteosarcoma; p105-Rb; pp110; pRb; RB; RB1; retinoblastoma 1; retinoblastoma suspectibility protein; retinoblastoma-associated protein RB1 OSRC, PPP1R130, RB, p105-Rb, p110-RB1, pRb, pp110 RB transcriptional corepressor 1 retinoblastoma-associated protein|GOS563 exon 17 substitution mutation causes premature stop|exon 17 tumor GOS561 substitution mutation causes premature stop|prepro-retinoblastoma-associated protein|protein phosphatase 1, regulatory subunit 130|retinoblastoma 1|retinoblastoma suspectibility protein

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on RB1, check out the RB1 Infographic

RB1 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for RB1: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for PROTP06400

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RB1 Retinoblastoma Associated Protein Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review RB1 Retinoblastoma Associated Protein Human Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RB1 Retinoblastoma Associated Protein Human Recombinant Protein

Size

Total: $250

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

In stock
Order Product
PROTP06400
$250.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.