Anti-AKR1D1 Antibody Picoband™

AKR1D1 antibody

Boster Bio Anti-AKR1D1 Antibody Picoband™ catalog # A05278-1. Tested in Flow Cytometry, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A05278-1
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, WB

Product Name

Anti-AKR1D1 Antibody Picoband™

View all AKR1D1 Antibodies

SKU/Catalog Number

A05278-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-AKR1D1 Antibody Picoband™ catalog # A05278-1. Tested in Flow Cytometry, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-AKR1D1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A05278-1)

Host

Rabbit

Contents

Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human AKR1D1, which shares 90.9% and 93.9% amino acid (aa) sequence identity with mouse and rat AKR1D1, respectively.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A05278-1 is reactive to AKR1D1 in Human, Mouse, Rat

Applications

A05278-1 is guaranteed for Flow Cytometry, WB Boster Guarantee

Observed Molecular Weight

37 kDa

Calculated molecular weight

37.377kDa

Background of AKR1D1

Human delta (4)-3-oxosteroid 5-beta-reductase (steroid 5-beta-reductase) catalyzes 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta (4)-3-one structure. This gene is mapped to 7q33. The enzyme encoded by this gene is responsible for the catalysis of the 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta (4)-3-one structure. Deficiency of this enzyme may contribute to hepatic dysfunction. Three transcript variants encoding different isoforms have been found for this gene. Other variants may be present, but their full-length natures have not been determined yet.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Flow Cytometry(Fixed), 1-3μg/1x106 cells

Validation Images & Assay Conditions

Gene/Protein Information For AKR1D1 (Source: Uniprot.org, NCBI)

Gene Name

AKR1D1

Full Name

Aldo-keto reductase family 1 member D1

Weight

37.377kDa

Superfamily

aldo/keto reductase family

Alternative Names

3o5bred; Aldo-keto reductase family 1 member D1,3-oxo-5-beta-steroid 4-dehydrogenase; aldo-keto reductase family 1, member D1 (delta4-3-ketosteroid-5-beta-reductase); CBAS2; Delta(4)-3-oxosteroid 5-beta-reductase; EC 1.3.1.3; SRD5B1beta polypeptide 1 (3-oxo-5 beta-steroid delta4-dehydrogenase beta 1) AKR1D1 3o5bred, CBAS2, SRD5B1 aldo-keto reductase family 1 member D1 aldo-keto reductase family 1 member D1|delta(4)-3-ketosteroid 5-beta-reductase|delta(4)-3-oxosteroid 5-beta-reductase|steroid-5-beta-reductase, beta polypeptide 1 (3-oxo-5 beta-steroid delta 4-dehydrogenase beta 1)

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on AKR1D1, check out the AKR1D1 Infographic

AKR1D1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for AKR1D1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A05278-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-AKR1D1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review Anti-AKR1D1 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

6 Customer Q&As for Anti-AKR1D1 Antibody Picoband™

Question

Is this A05278-1 anti-AKR1D1 antibody reactive to the isotypes of AKR1D1?

Verified Customer

Verified customer

Asked: 2020-04-21

Answer

The immunogen of A05278-1 anti-AKR1D1 antibody is A synthetic peptide corresponding to a sequence of human AKR1D1(EEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-04-21

Question

Is there a BSA free version of anti-AKR1D1 antibody A05278-1 available?

Verified Customer

Verified customer

Asked: 2020-03-17

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-AKR1D1 antibody A05278-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2020-03-17

Question

Does anti-AKR1D1 antibody A05278-1 work on primate IHC-F with liver?

Verified Customer

Verified customer

Asked: 2019-12-19

Answer

Our lab technicians have not tested anti-AKR1D1 antibody A05278-1 on primate. You can run a BLAST between primate and the immunogen sequence of anti-AKR1D1 antibody A05278-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated primate samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in primate liver in IHC-F, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-12-19

Question

Can you help my question with product A05278-1, anti-AKR1D1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-06-04

Answer

We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A05278-1 anti-AKR1D1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-06-04

Question

We are currently using anti-AKR1D1 antibody A05278-1 for mouse tissue, and we are well pleased with the ICC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on feline tissues as well?

K. Jackson

Verified customer

Asked: 2016-10-17

Answer

The anti-AKR1D1 antibody (A05278-1) has not been validated for cross reactivity specifically with feline tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2016-10-17

Question

I see that the anti-AKR1D1 antibody A05278-1 works with WB, what is the protocol used to produce the result images on the product page?

A. Li

Verified customer

Asked: 2014-04-15

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2014-04-15

Order DetailsPrice
A05278-1

100μg

$370
A05278-1-10ug

10μg sample (liquid)

$99
A05278-1-Biotin

100 μg Biotin conjugated

$570
A05278-1-Cy3

100 μg Cy3 conjugated

$570
A05278-1-Dylight488

100 μg Dylight488 conjugated

$570
A05278-1-Dylight550

100 μg Dylight550 conjugated

$570
A05278-1-Dylight594

100 μg Dylight594 conjugated

$570
A05278-1-FITC

100 μg FITC conjugated

$570
A05278-1-HRP

100 μg HRP conjugated

$570
A05278-1-APC

100 μg APC conjugated

$670
A05278-1-PE

100 μg PE conjugated

$670
A05278-1-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A05278-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.