Anti-APLP1 Antibody Picoband™

APLP-1 antibody

Boster Bio Anti-APLP1 Antibody Picoband™ catalog # PB9476. Tested in Flow Cytometry, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: PB9476
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IHC, ICC, WB

Product Name

Anti-APLP1 Antibody Picoband™

View all APLP-1 Antibodies

SKU/Catalog Number

PB9476

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-APLP1 Antibody Picoband™ catalog # PB9476. Tested in Flow Cytometry, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-APLP1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9476)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human APLP1, different from the related mouse sequence by three amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9476 is reactive to APLP1 in Human, Mouse, Rat

Applications

PB9476 is guaranteed for Flow Cytometry, IHC, ICC, WB Boster Guarantee

Observed Molecular Weight

85 kDa

Calculated molecular weight

72.176kDa

Background of APLP-1

Amyloid-precursor-like protein 1 (APLP1) is a membrane-associated glycoprotein, whose gene is homologous to the APP gene, which has been shown to be involved in the pathogenesis of Alzheimer's disease. APLP1 is predominantly expressed in brain, particularly in the cerebral cortex postsynaptic density. The human gene has been mapped to chromosomal region 19q13.1. The gene is 11.8 kb long and contains 17 exons. APLP1 has been considered a candidate gene for CNF. All exon regions of the gene were amplified by the polymerase chain reaction and sequenced from DNA of CNF patients. No differences were observed between CNF patients and controls, suggesting that mutations in APLP1 are not involved in the etiology of CNF.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Mouse, Rat, Human, By Heat
Western blot, 0.1-0.5μg/ml, Human, Rat
Immunohistochemistry (Frozen Section), 0.5-1μg/ml, Human
Immunocytochemistry, 0.5-1μg/ml, Human
Flow Cytometry, 1-3μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For APLP1 (Source: Uniprot.org, NCBI)

Gene Name

APLP1

Full Name

Amyloid-like protein 1

Weight

72.176kDa

Superfamily

APP family

Alternative Names

amyloid beta (A4) precursor-like protein 1; amyloid precursor-like protein 1; amyloid-like protein 1; APLP1; APLP-1; APLPAPLP-1 APLP1 APLP amyloid beta precursor like protein 1 amyloid-like protein 1|amyloid beta (A4) precursor-like protein 1|amyloid precursor-like protein 1

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on APLP1, check out the APLP1 Infographic

APLP1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for APLP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for PB9476

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-APLP1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review Anti-APLP1 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

6 Customer Q&As for Anti-APLP1 Antibody Picoband™

Question

Is this PB9476 anti-APLP1 antibody reactive to the isotypes of APLP1?

Verified Customer

Verified customer

Asked: 2020-04-13

Answer

The immunogen of PB9476 anti-APLP1 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human APLP1 (82-112aa RRCLRDPQRVLEYCRQMYPELQIARVEQATQ), different from the related mouse sequence by three amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-04-13

Question

We are currently using anti-APLP1 antibody PB9476 for mouse tissue, and we are satisfied with the Flow Cytometry results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on feline tissues as well?

Verified Customer

Verified customer

Asked: 2020-03-04

Answer

The anti-APLP1 antibody (PB9476) has not been validated for cross reactivity specifically with feline tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-03-04

Question

Is a blocking peptide available for product anti-APLP1 antibody (PB9476)?

Verified Customer

Verified customer

Asked: 2020-01-07

Answer

We do provide the blocking peptide for product anti-APLP1 antibody (PB9476). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2020-01-07

Question

I see that the anti-APLP1 antibody PB9476 works with Flow Cytometry, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-05-03

Answer

You can find protocols for Flow Cytometry on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-05-03

Question

Please see the WB image, lot number and protocol we used for cerebrospinal fluid using anti-APLP1 antibody PB9476. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2018-11-21

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-11-21

Question

Will anti-APLP1 antibody PB9476 work on bovine Flow Cytometry with cerebrospinal fluid?

D. Jha

Verified customer

Asked: 2017-02-14

Answer

Our lab technicians have not tested anti-APLP1 antibody PB9476 on bovine. You can run a BLAST between bovine and the immunogen sequence of anti-APLP1 antibody PB9476 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated bovine samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in bovine cerebrospinal fluid in Flow Cytometry, you can get your next antibody for free.

Boster Scientific Support

Answered: 2017-02-14

Order DetailsPrice
PB9476

100μg

$370
PB9476-10ug

10μg sample (liquid)

$99
PB9476-Biotin

100 μg Biotin conjugated

$570
PB9476-Cy3

100 μg Cy3 conjugated

$570
PB9476-Dylight488

100 μg Dylight488 conjugated

$570
PB9476-Dylight550

100 μg Dylight550 conjugated

$570
PB9476-Dylight594

100 μg Dylight594 conjugated

$570
PB9476-FITC

100 μg FITC conjugated

$570
PB9476-HRP

100 μg HRP conjugated

$570
PB9476-APC

100 μg APC conjugated

$670
PB9476-PE

100 μg PE conjugated

$670
PB9476-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9476
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.