Product Info Summary
SKU: | PB9476 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | Flow Cytometry, IHC, ICC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-APLP1 Antibody Picoband™
SKU/Catalog Number
PB9476
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-APLP1 Antibody Picoband™ catalog # PB9476. Tested in Flow Cytometry, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-APLP1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9476)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human APLP1, different from the related mouse sequence by three amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9476 is reactive to APLP1 in Human, Mouse, Rat
Applications
PB9476 is guaranteed for Flow Cytometry, IHC, ICC, WB Boster Guarantee
Observed Molecular Weight
85 kDa
Calculated molecular weight
72.176kDa
Background of APLP-1
Amyloid-precursor-like protein 1 (APLP1) is a membrane-associated glycoprotein, whose gene is homologous to the APP gene, which has been shown to be involved in the pathogenesis of Alzheimer's disease. APLP1 is predominantly expressed in brain, particularly in the cerebral cortex postsynaptic density. The human gene has been mapped to chromosomal region 19q13.1. The gene is 11.8 kb long and contains 17 exons. APLP1 has been considered a candidate gene for CNF. All exon regions of the gene were amplified by the polymerase chain reaction and sequenced from DNA of CNF patients. No differences were observed between CNF patients and controls, suggesting that mutations in APLP1 are not involved in the etiology of CNF.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Mouse, Rat, Human, By Heat
Western blot, 0.1-0.5μg/ml, Human, Rat
Immunohistochemistry (Frozen Section), 0.5-1μg/ml, Human
Immunocytochemistry, 0.5-1μg/ml, Human
Flow Cytometry, 1-3μg/1x106 cells, Human
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of APLP1 using anti-APLP1 antibody (PB9476).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: Rat Brain Tissue Lysate,
Lane 2: Rat Testis Tissue Lysate,
Lane 3: SGC Whole Cell Lysate,
Lane 4: 22RV1 Whole Cell Lysate,
Lane 5: MCF-7 Whole Cell Lysate.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-APLP1 antigen affinity purified polyclonal antibody (Catalog # PB9476) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for APLP1 at approximately 85KD. The expected band size for APLP1 is at 72KD.
Click image to see more details
Figure 2. IHC analysis of APLP1 using anti-APLP1 antibody (PB9476).
APLP1 was detected in paraffin-embedded section of Mouse Brain Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-APLP1 Antibody (PB9476) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of APLP1 using anti-APLP1 antibody (PB9476).
APLP1 was detected in paraffin-embedded section of Rat Brain Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-APLP1 Antibody (PB9476) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 4. Flow Cytometry analysis of SiHa cells using anti-APLP1 antibody (PB9476).
Overlay histogram showing SiHa cells stained with PB9476 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-APLP1 Antibody (PB9476,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Protein Target Info & Infographic
Gene/Protein Information For APLP1 (Source: Uniprot.org, NCBI)
Gene Name
APLP1
Full Name
Amyloid-like protein 1
Weight
72.176kDa
Superfamily
APP family
Alternative Names
amyloid beta (A4) precursor-like protein 1; amyloid precursor-like protein 1; amyloid-like protein 1; APLP1; APLP-1; APLPAPLP-1 APLP1 APLP amyloid beta precursor like protein 1 amyloid-like protein 1|amyloid beta (A4) precursor-like protein 1|amyloid precursor-like protein 1
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on APLP1, check out the APLP1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for APLP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-APLP1 Antibody Picoband™ (PB9476)
Hello CJ!
No publications found for PB9476
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-APLP1 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
Be the first to review Anti-APLP1 Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
6 Customer Q&As for Anti-APLP1 Antibody Picoband™
Question
Is this PB9476 anti-APLP1 antibody reactive to the isotypes of APLP1?
Verified Customer
Verified customer
Asked: 2020-04-13
Answer
The immunogen of PB9476 anti-APLP1 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human APLP1 (82-112aa RRCLRDPQRVLEYCRQMYPELQIARVEQATQ), different from the related mouse sequence by three amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-04-13
Question
We are currently using anti-APLP1 antibody PB9476 for mouse tissue, and we are satisfied with the Flow Cytometry results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on feline tissues as well?
Verified Customer
Verified customer
Asked: 2020-03-04
Answer
The anti-APLP1 antibody (PB9476) has not been validated for cross reactivity specifically with feline tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2020-03-04
Question
Is a blocking peptide available for product anti-APLP1 antibody (PB9476)?
Verified Customer
Verified customer
Asked: 2020-01-07
Answer
We do provide the blocking peptide for product anti-APLP1 antibody (PB9476). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2020-01-07
Question
I see that the anti-APLP1 antibody PB9476 works with Flow Cytometry, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2019-05-03
Answer
You can find protocols for Flow Cytometry on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-05-03
Question
Please see the WB image, lot number and protocol we used for cerebrospinal fluid using anti-APLP1 antibody PB9476. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2018-11-21
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2018-11-21
Question
Will anti-APLP1 antibody PB9476 work on bovine Flow Cytometry with cerebrospinal fluid?
D. Jha
Verified customer
Asked: 2017-02-14
Answer
Our lab technicians have not tested anti-APLP1 antibody PB9476 on bovine. You can run a BLAST between bovine and the immunogen sequence of anti-APLP1 antibody PB9476 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated bovine samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in bovine cerebrospinal fluid in Flow Cytometry, you can get your next antibody for free.
Boster Scientific Support
Answered: 2017-02-14