Product Info Summary
SKU: | A00852-2 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | Flow Cytometry, IHC, IHC-F, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-CFP Antibody Picoband™
SKU/Catalog Number
A00852-2
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-CFP Antibody Picoband™ catalog # A00852-2. Tested in Flow Cytometry, IHC, IHC-F, WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-CFP Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00852-2)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human CFP, which shares 86.1% amino acid (aa) sequence identity with both mouse and rat CFP.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A00852-2 is reactive to CFP in Human, Mouse, Rat
Applications
A00852-2 is guaranteed for Flow Cytometry, IHC, IHC-F, WB Boster Guarantee
Observed Molecular Weight
51 kDa
Calculated molecular weight
51.276kDa
Background of Properdin
Properdin (factor P) is a plasma protein that is active in the alternative complement pathway of the innate immune system. It is mapped to Xp11.23. This protein binds to many microbial surfaces and apoptotic cells and stabilizes the C3- and C5-convertase enzyme complexes in a feedback loop that ultimately leads to formation of the membrane attack complex and lysis of the target cell. Mutations in this gene result in two forms of properdin deficiency, which results in high susceptibility to meningococcal infections. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
Immunohistochemistry (Frozen Section), 0.5-1μg/ml
Flow Cytometry, 1-3μg/1x106 cells
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of CFP using anti-CFP antibody (A00852-2).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human placenta tissue lysates,
Lane 2: human U-937 whole cell lysate,
Lane 3: rat brain tissue lysates,
Lane 4: mouse brain tissue lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-CFP antigen affinity purified polyclonal antibody (Catalog # A00852-2) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for CFP at approximately 51KD. The expected band size for CFP is at 51KD.
Click image to see more details
Figure 2. IHC analysis of CFP using anti-CFP antibody (A00852-2).
CFP was detected in paraffin-embedded section of human cholangiocarcinoma tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-CFP Antibody (A00852-2) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of CFP using anti-CFP antibody (A00852-2).
CFP was detected in paraffin-embedded section of human liver cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-CFP Antibody (A00852-2) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 4. IHC analysis of CFP using anti-CFP antibody (A00852-2).
CFP was detected in paraffin-embedded section of human placenta tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-CFP Antibody (A00852-2) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 5. IHC analysis of CFP using anti-CFP antibody (A00852-2).
CFP was detected in paraffin-embedded section of mouse kidney tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-CFP Antibody (A00852-2) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 6. IHC analysis of CFP using anti-CFP antibody (A00852-2).
CFP was detected in paraffin-embedded section of rat liver tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-CFP Antibody (A00852-2) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 7. IHC analysis of CFP using anti-CFP antibody (A00852-2).
CFP was detected in paraffin-embedded section of rat intestine tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-CFP Antibody (A00852-2) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 8. Flow Cytometry analysis of THP-1 cells using anti-CFP antibody (A00852-2).
Overlay histogram showing THP-1 cells stained with A00852-2 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CFP Antibody (A00852-2,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Protein Target Info & Infographic
Gene/Protein Information For CFP (Source: Uniprot.org, NCBI)
Gene Name
CFP
Full Name
Properdin
Weight
51.276kDa
Alternative Names
BFD; CFP; Complement Factor P; complement factor properdin; PFC; PFCcomplement; PFD; Properdin CFP BFD, PFC, PFD, PROPERDIN complement factor properdin properdin|complement factor P|properdin P factor, complement
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on CFP, check out the CFP Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for CFP: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-CFP Antibody Picoband™ (A00852-2)
Hello CJ!
No publications found for A00852-2
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-CFP Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
Be the first to review Anti-CFP Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
16 Customer Q&As for Anti-CFP Antibody Picoband™
Question
We are interested in using your anti-CFP antibody for defense response to bacterium studies. Has this antibody been tested with western blotting on brain tissue? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2020-04-30
Answer
Thanks for your inquiry. This A00852-2 anti-CFP antibody is validated on human cholangiocarcinoma tissue, placenta tissue, rat liver tissue, brain tissue, mouse kidney tissue, liver cancer tissue, intestine tissue. It is guaranteed to work for Flow Cytometry, IHC-P, IHC-F, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2020-04-30
Question
Please see the WB image, lot number and protocol we used for plasma using anti-CFP antibody A00852-2. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-12-20
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-12-20
Question
We are currently using anti-CFP antibody A00852-2 for rat tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on goat tissues as well?
Verified Customer
Verified customer
Asked: 2019-09-16
Answer
The anti-CFP antibody (A00852-2) has not been validated for cross reactivity specifically with goat tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-09-16
Question
Is this A00852-2 anti-CFP antibody reactive to the isotypes of CFP?
Verified Customer
Verified customer
Asked: 2019-09-05
Answer
The immunogen of A00852-2 anti-CFP antibody is A synthetic peptide corresponding to a sequence of human CFP (MVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKR). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-09-05
Question
Is there a BSA free version of anti-CFP antibody A00852-2 available?
Verified Customer
Verified customer
Asked: 2019-08-27
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-CFP antibody A00852-2 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2019-08-27
Question
Would A00852-2 anti-CFP antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2019-02-04
Answer
It shows on the product datasheet, A00852-2 anti-CFP antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-02-04
Question
Is a blocking peptide available for product anti-CFP antibody (A00852-2)?
H. Dhar
Verified customer
Asked: 2018-08-16
Answer
We do provide the blocking peptide for product anti-CFP antibody (A00852-2). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2018-08-16
Question
We have observed staining in human spleen. Any tips? Is anti-CFP antibody supposed to stain spleen positively?
Verified Customer
Verified customer
Asked: 2018-08-14
Answer
From literature spleen does express CFP. From Uniprot.org, CFP is expressed in leukocyte, spleen, plasma, among other tissues. Regarding which tissues have CFP expression, here are a few articles citing expression in various tissues:
Plasma, Pubmed ID: 16335952
Spleen, Pubmed ID: 15489334
Boster Scientific Support
Answered: 2018-08-14
Question
I am interested in to test anti-CFP antibody A00852-2 on rat plasma for research purposes, then I may be interested in using anti-CFP antibody A00852-2 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
S. Baker
Verified customer
Asked: 2018-07-19
Answer
The products we sell, including anti-CFP antibody A00852-2, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2018-07-19
Question
I was wanting to use your anti-CFP antibody for WB for rat plasma on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for rat plasma identification?
K. Krishna
Verified customer
Asked: 2018-07-04
Answer
It shows on the product datasheet, A00852-2 anti-CFP antibody has been tested for Flow Cytometry, IHC-P, IHC-F, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat plasma in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2018-07-04
Question
Does anti-CFP antibody A00852-2 work for WB with plasma?
Verified Customer
Verified customer
Asked: 2018-05-28
Answer
According to the expression profile of plasma, CFP is highly expressed in plasma. So, it is likely that anti-CFP antibody A00852-2 will work for WB with plasma.
Boster Scientific Support
Answered: 2018-05-28
Question
I see that the anti-CFP antibody A00852-2 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2017-11-06
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2017-11-06
Question
Our lab used your anti-CFP antibody for IHC-P on spleen last year. I am using mouse, and I plan to use the antibody for Flow Cytometry next. We need examining spleen as well as leukocyte in our next experiment. Do you have any suggestion on which antibody would work the best for Flow Cytometry?
P. Johnson
Verified customer
Asked: 2016-12-12
Answer
I have checked the website and datasheets of our anti-CFP antibody and it appears that A00852-2 has been validated on mouse in both IHC-P and Flow Cytometry. Thus A00852-2 should work for your application. Our Boster satisfaction guarantee will cover this product for Flow Cytometry in mouse even if the specific tissue type has not been validated. We do have a comprehensive range of products for Flow Cytometry detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2016-12-12
Question
Our lab were content with the WB result of your anti-CFP antibody. However we have observed positive staining in spleen secreted. using this antibody. Is that expected? Could you tell me where is CFP supposed to be expressed?
M. Evans
Verified customer
Asked: 2015-05-14
Answer
From literature, spleen does express CFP. Generally CFP expresses in secreted. Regarding which tissues have CFP expression, here are a few articles citing expression in various tissues:
Plasma, Pubmed ID: 16335952
Spleen, Pubmed ID: 15489334
Boster Scientific Support
Answered: 2015-05-14
Question
My question regarding product A00852-2, anti-CFP antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
A. Li
Verified customer
Asked: 2015-04-24
Answer
We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00852-2 anti-CFP antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2015-04-24
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for plasma using anti-CFP antibody A00852-2. Let me know if you need anything else.
R. Brown
Verified customer
Asked: 2014-04-03
Answer
Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2014-04-03