Anti-CORD2/CRX Antibody Picoband™

CRX/CORD2 antibody

Boster Bio Anti-CORD2/CRX Antibody Picoband™ catalog # A02202-1. Tested in WB applications. This antibody reacts with Human.

Product Info Summary

SKU: A02202-1
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: WB

Product Name

Anti-CORD2/CRX Antibody Picoband™

View all CRX/CORD2 Antibodies

SKU/Catalog Number

A02202-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-CORD2/CRX Antibody Picoband™ catalog # A02202-1. Tested in WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-CORD2/CRX Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A02202-1)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human CORD2, identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A02202-1 is reactive to CRX in Human

Applications

A02202-1 is guaranteed for WB Boster Guarantee

Observed Molecular Weight

37 kDa

Calculated molecular weight

32.261kDa

Background of CRX/CORD2

Cone-rod homeobox protein is a protein that in humans is encoded by the CRX gene. The protein encoded by this gene is a photoreceptor-specific transcription factor which plays a role in the differentiation of photoreceptor cells. This homeodomain protein is necessary for the maintenance of normal cone and rod function. Mutations in this gene are associated with photoreceptor degeneration, Leber congenital amaurosis type III and the autosomal dominant cone-rod dystrophy 2. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some variants has not been determined.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human

Validation Images & Assay Conditions

Gene/Protein Information For CRX (Source: Uniprot.org, NCBI)

Gene Name

CRX

Full Name

Cone-rod homeobox protein

Weight

32.261kDa

Superfamily

paired homeobox family

Alternative Names

cone-rod homeobox; CORD2; CRDcone-rod homeobox protein; CRX; LCA7; LCA7orthodenticle homeobox 3; OTX3 CRX CORD2, CRD, LCA7, OTX3 cone-rod homeobox cone-rod homeobox protein|orthodenticle homeobox 3

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on CRX, check out the CRX Infographic

CRX infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CRX: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A02202-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-CORD2/CRX Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review Anti-CORD2/CRX Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

2 Customer Q&As for Anti-CORD2/CRX Antibody Picoband™

Question

We are currently using anti-CORD2/CRX antibody A02202-1 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human. Is it possible that the antibody can work on feline tissues as well?

Verified Customer

Verified customer

Asked: 2020-01-24

Answer

The anti-CORD2/CRX antibody (A02202-1) has not been tested for cross reactivity specifically with feline tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-01-24

Question

Is this A02202-1 anti-CORD2/CRX antibody reactive to the isotypes of CRX?

B. Kulkarni

Verified customer

Asked: 2019-08-14

Answer

The immunogen of A02202-1 anti-CORD2/CRX antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human CORD2 (265-299aa DSLEFKDPTGTWKFTYNPMDPLDYKDQSAWKFQIL), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-08-14

Order DetailsPrice
A02202-1

100μg

$370
A02202-1-10ug

10μg sample (liquid)

$99
A02202-1-Biotin

100 μg Biotin conjugated

$570
A02202-1-Cy3

100 μg Cy3 conjugated

$570
A02202-1-Dylight488

100 μg Dylight488 conjugated

$570
A02202-1-Dylight550

100 μg Dylight550 conjugated

$570
A02202-1-Dylight594

100 μg Dylight594 conjugated

$570
A02202-1-FITC

100 μg FITC conjugated

$570
A02202-1-HRP

100 μg HRP conjugated

$570
A02202-1-APC

100 μg APC conjugated

$670
A02202-1-PE

100 μg PE conjugated

$670
A02202-1-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A02202-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.