Product Info Summary
SKU: | PB9253 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-HIF-1-alpha/HIF1A Antibody Picoband™
View all HIF-1 alpha Antibodies
SKU/Catalog Number
PB9253
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-HIF-1-alpha/HIF1A Antibody Picoband™ catalog # PB9253. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-HIF-1-alpha/HIF1A Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9253)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminal of human HIF-1-alpha, different from the related mouse and rat sequences by three amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9253 is reactive to HIF1A in Human, Mouse, Rat
Applications
PB9253 is guaranteed for IHC, WB Boster Guarantee
Observed Molecular Weight
115-120 kDa
Calculated molecular weight
92.67kDa
Background of HIF-1 alpha
HIF-1α (Hypoxia-inducible factor 1α, HIF1A) is a transcription factor that mediates cellular and systemic homeostatic responses to reduced O2 availability in mammals, including angiogenesis, erythropoiesis and glycolysis. This gene was mapped to 14q21-q24. HIF-1α transactivate genes required for energy metabolism and tissue perfusion and is necessary for embryonic development and tumor explant growth. HIF-1alpha is over expressed during carcinogenesis, myocardial infarction and wound healing. It is crucial for the cellular response to hypoxia and is frequently over expressed in human cancers, resulting in the activation of genes essential for cell survival. HIF-1α regulates the survival and function in the inflammatory microenvironment directly. It is a transcription factor that plays a pivotal role in cellular adaptation to changes in oxygen availability.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Western blot, 0.1-0.5μg/ml, Human, Mouse
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of HIF-1-alpha/HIF1A using anti-HIF-1-alpha/HIF1A antibody (PB9253).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human PC-3 whole cell lysates,
Lane 2: human Caco-2 whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-HIF-1-alpha/HIF1A antigen affinity purified polyclonal antibody (Catalog # PB9253) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for HIF-1-alpha/HIF1A at approximately 115-120KD. The expected band size for HIF-1-alpha/HIF1A is at 97KD.
Click image to see more details
Figure 2. IHC analysis of HIF 1 alpha using anti-HIF 1 alpha antibody (PB9253).
HIF 1 alpha was detected in paraffin-embedded section of mouse intestine tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-HIF 1 alpha Antibody (PB9253) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of HIF 1 alpha using anti-HIF 1 alpha antibody (PB9253).
HIF 1 alpha was detected in paraffin-embedded section of rat intestine tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-HIF 1 alpha Antibody (PB9253) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 4. IHC analysis of HIF 1 alpha using anti-HIF 1 alpha antibody (PB9253).
HIF 1 alpha was detected in paraffin-embedded section of human intestinal cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-HIF 1 alpha Antibody (PB9253) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Protein Target Info & Infographic
Gene/Protein Information For HIF1A (Source: Uniprot.org, NCBI)
Gene Name
HIF1A
Full Name
Hypoxia-inducible factor 1-alpha
Weight
92.67kDa
Alternative Names
AINT; HIF-1 alpha; HIF1A; ARNT interacting protein; ARNT-interacting protein; Basic-helix-loop-helix-PAS protein MOP1; BHLHE78; Class E basic helix-loop-helix protein 78; H1alpha67; HIF 1A; HIF1 alpha; HIF-1 alpha; HIF1; HIF1A; HIF-1a; HIF-1alpha; HIF-1-alpha; HIF1-alpha; hypoxia inducible factor 1 alpha subunit, hypoxia inducible factor 1 subunit alpha; hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor); hypoxia-inducible factor 1-alpha; Member of PAS protein 1; member of PAS superfamily 1; MOP1; PAS domain-containing protein 8; PASD8 HIF1A HIF-1-alpha, HIF-1A, HIF-1alpha, HIF1, HIF1-ALPHA, MOP1, PASD8, bHLHe78 hypoxia inducible factor 1 subunit alpha hypoxia-inducible factor 1-alpha|ARNT interacting protein|PAS domain-containing protein 8|basic-helix-loop-helix-PAS protein MOP1|class E basic helix-loop-helix protein 78|hypoxia inducible factor 1 alpha subunit|hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor)|hypoxia-inducible factor1alpha|member of PAS protein 1|member of PAS superfamily 1
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on HIF1A, check out the HIF1A Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for HIF1A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-HIF-1-alpha/HIF1A Antibody Picoband™ (PB9253)
Hello CJ!
PB9253 has been cited in 74 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
AhR activation attenuates calcium oxalate nephrocalcinosis by diminishing M1 macrophage polarization and promoting M2 macrophage polarization
Expression of hypoxia-inducible factor 1 alpha and oligodendrocyte lineage gene-1 in cultured brain slices after oxygen-glucose deprivation
Hypoxia-inducible factor-1α modulates the down-regulation of the homeodomain protein CDX2 in colorectal cancer
Nitric oxide signaling pathway activation inhibits the immune escape of pancreatic carcinoma cells
Role of hypoxia-inducible factor-1α in pathogenesis and disease evaluation of ulcerative colitis
Oxidative stress and hypoxia-induced factor 1α expression in gastric ischemia
Effect of Negative Pressure on Human Bone Marrow Mesenchymal Stem Cells In Vitro
The Role of Psychologic Stress‐Induced Hypoxia‐Inducible Factor‐1α in Rat Experimental Periodontitis
CD47 deficiency in tumor stroma promotes tumor progression by enhancing angiogenesis
Expression of Rac1, HIF-1α, and VEGF in Gastric Carcinoma: Correlation with Angiogenesis and Prognosis
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-HIF-1-alpha/HIF1A Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
Be the first to review Anti-HIF-1-alpha/HIF1A Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
18 Customer Q&As for Anti-HIF-1-alpha/HIF1A Antibody Picoband™
Question
Our lab used your anti-HIF-1-alpha/HIF1A antibody for WB on liver last year. I am using rat, and We intend to use the antibody for IHC next. My lab would like examining liver as well as glial tumor in our next experiment. Could give a recommendation on which antibody would work the best for IHC?
Verified Customer
Verified customer
Asked: 2020-04-16
Answer
I have checked the website and datasheets of our anti-HIF-1-alpha/HIF1A antibody and I see that PB9253 has been validated on rat in both WB and IHC. Thus PB9253 should work for your application. Our Boster satisfaction guarantee will cover this product for IHC in rat even if the specific tissue type has not been validated. We do have a comprehensive range of products for IHC detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2020-04-16
Question
Please see the WB image, lot number and protocol we used for visceral pleura using anti-HIF-1-alpha/HIF1A antibody PB9253. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2020-01-27
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-01-27
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for visceral pleura using anti-HIF-1-alpha/HIF1A antibody PB9253. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2020-01-13
Answer
I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-01-13
Question
you antibody to test anti-HIF-1-alpha/HIF1A antibody PB9253 on human visceral pleura for research purposes, then I may be interested in using anti-HIF-1-alpha/HIF1A antibody PB9253 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2020-01-09
Answer
The products we sell, including anti-HIF-1-alpha/HIF1A antibody PB9253, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2020-01-09
Question
We want using your anti-HIF-1-alpha/HIF1A antibody for positive regulation of blood vessel endothelial cell migration studies. Has this antibody been tested with western blotting on mouse intestine tissue? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2019-08-09
Answer
Thank you for your inquiry. This PB9253 anti-HIF-1-alpha/HIF1A antibody is validated on mouse intestine tissue, intestinal cancer tissue, rat intestine tissue. It is guaranteed to work for IHC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2019-08-09
Question
What specific lysis buffer and blocking buffer was used in the PB9253 Antibody protocol?
Verified customer
Asked: 2019-07-15
Answer
The Lysis buffer used in the Anti-HIF-1-alpha/HIF1A Antibody Picoband PB9253 protocol was RIPA lysis buffer. The Blocking buffer was 5% Non-fat Milk/ TBS.
Boster Scientific Support
Answered: 2019-07-15
Question
Do you have a WB testing with cobalt chloride treatment of the cells prior to lysing/testing for PB9253 Antibody?
Verified customer
Asked: 2019-07-10
Answer
Our lab did not perform a WB test on PON1 Paraoxonase-1 Human Recombinant Protein PROTP27169 with cobalt chloride treatment of the cells prior to lysing/testing.
Boster Scientific Support
Answered: 2019-07-10
Question
We have observed staining in human glial tumor. Are there any suggestions? Is anti-HIF-1-alpha/HIF1A antibody supposed to stain glial tumor positively?
Verified Customer
Verified customer
Asked: 2019-06-17
Answer
Based on literature glial tumor does express HIF1A. Based on Uniprot.org, HIF1A is expressed in visceral pleura, hepatoma, glial tumor, liver, choriocarcinoma placenta, among other tissues. Regarding which tissues have HIF1A expression, here are a few articles citing expression in various tissues:
Choriocarcinoma, and Placenta, Pubmed ID: 15489334
Hepatoma, Pubmed ID: 9079689
Liver, Pubmed ID: 12508121
Boster Scientific Support
Answered: 2019-06-17
Question
Is a blocking peptide available for product anti-HIF-1-alpha/HIF1A antibody (PB9253)?
Verified Customer
Verified customer
Asked: 2019-05-13
Answer
We do provide the blocking peptide for product anti-HIF-1-alpha/HIF1A antibody (PB9253). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-05-13
Question
I see that the anti-HIF-1-alpha/HIF1A antibody PB9253 works with IHC, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2018-06-15
Answer
You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2018-06-15
Question
Is this PB9253 anti-HIF-1-alpha/HIF1A antibody reactive to the isotypes of HIF1A?
Verified Customer
Verified customer
Asked: 2018-05-29
Answer
The immunogen of PB9253 anti-HIF-1-alpha/HIF1A antibody is A synthetic peptide corresponding to a sequence at the C-terminal of human HIF-1-alpha (703-732aa EEELNPKILALQNAQRKRKMEHDGSLFQAV), different from the related mouse and rat sequences by three amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2018-05-29
Question
Will anti-HIF-1-alpha/HIF1A antibody PB9253 work for IHC with visceral pleura?
Verified Customer
Verified customer
Asked: 2018-01-30
Answer
According to the expression profile of visceral pleura, HIF1A is highly expressed in visceral pleura. So, it is likely that anti-HIF-1-alpha/HIF1A antibody PB9253 will work for IHC with visceral pleura.
Boster Scientific Support
Answered: 2018-01-30
Question
Does PB9253 anti-HIF-1-alpha/HIF1A antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2017-09-13
Answer
You can see on the product datasheet, PB9253 anti-HIF-1-alpha/HIF1A antibody as been tested on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2017-09-13
Question
Is there a BSA free version of anti-HIF-1-alpha/HIF1A antibody PB9253 available?
D. Parker
Verified customer
Asked: 2017-08-11
Answer
I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-HIF-1-alpha/HIF1A antibody PB9253 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2017-08-11
Question
We were content with the WB result of your anti-HIF-1-alpha/HIF1A antibody. However we have seen positive staining in glial tumor cytoplasm. using this antibody. Is that expected? Could you tell me where is HIF1A supposed to be expressed?
J. Bhatt
Verified customer
Asked: 2015-04-20
Answer
From what I have seen in literature, glial tumor does express HIF1A. Generally HIF1A expresses in cytoplasm. Regarding which tissues have HIF1A expression, here are a few articles citing expression in various tissues:
Choriocarcinoma, and Placenta, Pubmed ID: 15489334
Hepatoma, Pubmed ID: 9079689
Liver, Pubmed ID: 12508121
Boster Scientific Support
Answered: 2015-04-20
Question
I was wanting to use your anti-HIF-1-alpha/HIF1A antibody for IHC for human visceral pleura on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human visceral pleura identification?
P. Evans
Verified customer
Asked: 2014-01-24
Answer
As indicated on the product datasheet, PB9253 anti-HIF-1-alpha/HIF1A antibody has been tested for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human visceral pleura in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2014-01-24
Question
I have a question about product PB9253, anti-HIF-1-alpha/HIF1A antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
E. Mitchell
Verified customer
Asked: 2013-06-27
Answer
We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9253 anti-HIF-1-alpha/HIF1A antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2013-06-27
Question
We are currently using anti-HIF-1-alpha/HIF1A antibody PB9253 for human tissue, and we are happy with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on monkey tissues as well?
C. Thomas
Verified customer
Asked: 2013-01-22
Answer
The anti-HIF-1-alpha/HIF1A antibody (PB9253) has not been validated for cross reactivity specifically with monkey tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2013-01-22