Click image to see more details
Product Info Summary
| SKU: | A01425-1 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human |
| Host: | Rabbit |
| Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-IL6R Antibody Picoband™
SKU/Catalog Number
A01425-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-IL6R Antibody Picoband™ catalog # A01425-1. Tested in WB applications. This antibody reacts with Human.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-IL6R Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01425-1)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human IL6R.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A01425-1 is reactive to IL6R in Human
Applications
A01425-1 is guaranteed for WB Boster Guarantee
Observed Molecular Weight
52 kDa
Calculated molecular weight
51.548kDa
Background of Il6r
Interleukin 6 receptor (IL6R), also known as CD126 (Cluster of Differentiation 126), is a type I cytokine receptor. This gene encodes a subunit of the interleukin 6 (IL6) receptor complex. Interleukin 6 is a potent pleiotropic cytokine that regulates cell growth and differentiation and plays an important role in the immune response. The IL6 receptor is a protein complex consisting of this protein and interleukin 6 signal transducer (IL6ST/GP130/IL6-beta), a receptor subunit also shared by many other cytokines. Dysregulated production of IL6 and this receptor are implicated in the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. Alternatively spliced transcript variants encoding distinct isoforms have been reported. A pseudogene of this gene is found on chromosome 9.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of IL6R using anti-IL6R antibody (A01425-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human A549 whole cell lysate.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-IL6R antigen affinity purified polyclonal antibody (Catalog # A01425-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for IL6R at approximately 52KD. The expected band size for IL6R is at 52KD.
Protein Target Info & Infographic
Gene/Protein Information For IL6R (Source: Uniprot.org, NCBI)
Gene Name
IL6R
Full Name
Interleukin-6 receptor subunit alpha
Weight
51.548kDa
Superfamily
type I cytokine receptor family
Alternative Names
CD126; gp80; IL-6 R alpha; IL6Q; IL6R alpha; IL-6R alpha; IL6R; IL-6R-1; IL6RA; IL-6Ra; IL6RQ; interleukin 6 receptor IL6R CD126, HIES5, IL-1Ra, IL-6R, IL-6R-1, IL-6RA, IL6Q, IL6QTLA, IL6RQ, gp80, IL6R interleukin 6 receptor interleukin-6 receptor subunit alpha|CD126 antigen|IL-6 receptor subunit alpha|membrane glycoprotein 80
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on IL6R, check out the IL6R Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IL6R: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-IL6R Antibody Picoband™ (A01425-1)
Hello CJ!
A01425-1 has been cited in 2 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
The Role of IL-6RA in UHMWPE Promotes Proliferation in Fibro-Like Synovial Cells
The Role of IL-6RA in UHMWPE Promotes Proliferation in Fibro-Like Synovial Cells
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-IL6R Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
Be the first to review Anti-IL6R Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
16 Customer Q&As for Anti-IL6R Antibody Picoband™
Question
Is there a BSA free version of anti-IL6R antibody A01425-1 available?
Verified Customer
Verified customer
Asked: 2020-01-16
Answer
Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-IL6R antibody A01425-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2020-01-16
Question
Would anti-IL6R antibody A01425-1 work on monkey WB with trachea?
Verified Customer
Verified customer
Asked: 2020-01-13
Answer
Our lab technicians have not tested anti-IL6R antibody A01425-1 on monkey. You can run a BLAST between monkey and the immunogen sequence of anti-IL6R antibody A01425-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated monkey samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in monkey trachea in WB, you can get your next antibody for free.
Boster Scientific Support
Answered: 2020-01-13
Question
I am looking for to test anti-IL6R antibody A01425-1 on human lymph for research purposes, then I may be interested in using anti-IL6R antibody A01425-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-11-04
Answer
The products we sell, including anti-IL6R antibody A01425-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-11-04
Question
Our team were well pleased with the WB result of your anti-IL6R antibody. However we have seen positive staining in blood isoform 1: basolateral cell membrane using this antibody. Is that expected? Could you tell me where is IL6R supposed to be expressed?
Verified Customer
Verified customer
Asked: 2019-09-03
Answer
From what I have seen in literature, blood does express IL6R. Generally IL6R expresses in isoform 1: basolateral cell membrane. Regarding which tissues have IL6R expression, here are a few articles citing expression in various tissues:
Kidney, Pubmed ID: 16710414
Lymph, Pubmed ID: 15489334
Trachea, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2019-09-03
Question
I was wanting to use your anti-IL6R antibody for WB for human lymph on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human lymph identification?
P. Wu
Verified customer
Asked: 2019-08-06
Answer
It shows on the product datasheet, A01425-1 anti-IL6R antibody has been tested for WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human lymph in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-08-06
Question
Is this A01425-1 anti-IL6R antibody reactive to the isotypes of IL6R?
Verified Customer
Verified customer
Asked: 2019-06-10
Answer
The immunogen of A01425-1 anti-IL6R antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human IL6R (379-419aa LLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPR). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-06-10
Question
I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for lymph using anti-IL6R antibody A01425-1. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2019-05-16
Answer
Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-05-16
Question
Can you help my question with product A01425-1, anti-IL6R antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2018-11-28
Answer
It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A01425-1 anti-IL6R antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2018-11-28
Question
Will anti-IL6R antibody A01425-1 work for WB with lymph?
Verified Customer
Verified customer
Asked: 2018-11-22
Answer
According to the expression profile of lymph, IL6R is highly expressed in lymph. So, it is likely that anti-IL6R antibody A01425-1 will work for WB with lymph.
Boster Scientific Support
Answered: 2018-11-22
Question
I see that the anti-IL6R antibody A01425-1 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2018-01-12
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2018-01-12
Question
Is a blocking peptide available for product anti-IL6R antibody (A01425-1)?
Verified Customer
Verified customer
Asked: 2017-12-01
Answer
We do provide the blocking peptide for product anti-IL6R antibody (A01425-1). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2017-12-01
Question
Would A01425-1 anti-IL6R antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2017-11-13
Answer
You can see on the product datasheet, A01425-1 anti-IL6R antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2017-11-13
Question
We have seen staining in human lymph. Are there any suggestions? Is anti-IL6R antibody supposed to stain lymph positively?
E. Lewis
Verified customer
Asked: 2015-04-15
Answer
Based on literature lymph does express IL6R. Based on Uniprot.org, IL6R is expressed in blood, trachea, kidney, lymph, among other tissues. Regarding which tissues have IL6R expression, here are a few articles citing expression in various tissues:
Kidney, Pubmed ID: 16710414
Lymph, Pubmed ID: 15489334
Trachea, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2015-04-15
Question
I am interested in using your anti-IL6R antibody for hepatic immune response studies. Has this antibody been tested with western blotting on human a549? We would like to see some validation images before ordering.
V. Krishna
Verified customer
Asked: 2013-10-31
Answer
We appreciate your inquiry. This A01425-1 anti-IL6R antibody is tested on human a549, a549 whole cell lysate. It is guaranteed to work for WB in human. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2013-10-31
Question
I have attached the WB image, lot number and protocol we used for lymph using anti-IL6R antibody A01425-1. Please let me know if you require anything else.
W. Patel
Verified customer
Asked: 2013-09-17
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2013-09-17
Question
We are currently using anti-IL6R antibody A01425-1 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human. Is it possible that the antibody can work on canine tissues as well?
E. Anderson
Verified customer
Asked: 2013-04-17
Answer
The anti-IL6R antibody (A01425-1) has not been tested for cross reactivity specifically with canine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in canine you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2013-04-17
