Anti-Integrin alphaD ITGAD Antibody

Product Name

Anti-Integrin alphaD ITGAD Antibody

View all Integrin alpha D/CD11d Antibodies

SKU/Catalog Number

A09283

Size

100μl

Form

Liquid

Description

Boster Bio Anti-Integrin alphaD ITGAD Antibody catalog # A09283. Tested in IHC, WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20°C for one year. For short term storage and frequent use, store at 4°C for up to one month. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Integrin alphaD ITGAD Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # A09283)

Host

Rabbit

Contents

Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide.

Clonality

Polyclonal

Clone Number

1A5

Isotype

IgG

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse Synthetic peptide TLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDAEEPTEDEVFDFGDTMVH

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross reactivity with other proteins.

Reactive Species

A09283 is reactive to ITGAD in Human

Applications

A09283 is guaranteed for IHC, WB Boster Guarantee

Observed Molecular Weight

39 kDa

Calculated molecular weight

126.758kDa

Background of Integrin alpha D/CD11d

APC11 is also known as Anaphase promoting complex subunit 11, APC11, Cyclosome subunit 11, Hepatocellular carcinoma associated RING finger protein, and HSPC214. APC11 is a component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G₁ phase of the cell cycle. APC11 may function to recruit the E2 ubiquitin-conjugating enzymes to the complex. APC11 interacts with the cullin domain of ANAPC2 and also interacts with UBE2D2. APC11 shows both a cytoplasmic and nuclear localization. APC11 is expressed at high levels in skeletal muscle and heart; in moderate levels in brain, kidney, and liver; and at low levels in colon, thymus, spleen, small intestine, placenta, lung and peripheral blood leukocyte. APC11 is a member of the RING-type zinc finger family and is auto-ubiquitinylated.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

WB, 1:500-1:2000
IHC-P, 1:100-1:300

Validation Images & Assay Conditions

Click image to see more details

Immunohistochemistry (IHC) analysis of paraffin-embedded Human Lung, antibody was diluted at 1:100.

Click image to see more details

Western Blot (WB) analysis of 4T1, 293 cells using Integrin alphaD Polyclonal antibody.

Click image to see more details

Immunohistochemistry (IHC) analysis of paraffin-embedded Human Spleen, antibody was diluted at 1:100.

Gene/Protein Information For ITGAD (Source: Uniprot.org, NCBI)

Alternative Names

ADB2; CD11 antigen-like family member D; CD11d; FLJ39841; Integrin alpha D; integrin alpha-D; integrin, alpha D; Leukointegrin Alpha D ITGAD ADB2, CD11D integrin subunit alpha D integrin alpha-D|CD11 antigen-like family member D|beta-2 integrin alphaD subunit|leukointegrin alpha D

For more info on ITGAD, check out the ITGAD Infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ITGAD: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Take me to the ITGAD Infographic

Here are featured tools and databases that you might find useful.

• Boster's Pathways Library
• Protein Databases
• Bioscience Research Protocol Resources
• Data Processing & Analysis Software
• Photo Editing Software
• Scientific Literature Resources
• Research Paper Management Tools
• Molecular Biology Software
• Primer Design Tools
• Bioinformatics Tools
• Phylogenetic Tree Analysis