Product Info Summary
SKU: | PB9652 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | Flow Cytometry, IF, IHC, ICC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-KChIP2/KCNIP2 Antibody Picoband™
SKU/Catalog Number
PB9652
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-KChIP2/KCNIP2 Antibody Picoband™ catalog # PB9652. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-KChIP2/KCNIP2 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9652)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human KChIP2, different from the related mouse and rat sequences by one amino acid.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9652 is reactive to KCNIP2 in Human, Mouse, Rat
Applications
PB9652 is guaranteed for Flow Cytometry, IF, IHC, ICC, WB Boster Guarantee
Observed Molecular Weight
31 kDa
Calculated molecular weight
30.907kDa
Background of KChIP2
Kv channel-interacting protein 2 also known as KChIP2 is a protein that in humans is encoded by the KCNIP2 gene. This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins, which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. And they are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Alternative splicing results in multiple transcript variant encoding different isoforms.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
Flow Cytometry, 1-3μg/1x106 cells, Human
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of KCNA5 using anti-KCNA5 antibody (PB9652).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours.
Lane 1: Rat Brain Tissue Lysate at 50ug,
Lane 2: Rat Cardiac Muscle Tissue Lysate at 50ug,
Lane 3: Mouse Cardiac Muscle Tissue Lysate at 50ug,
Lane 4: 22RV1 Whole Cell Lysate at 40ug.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-KCNA5 antigen affinity purified polyclonal antibody (Catalog # PB9652) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for KCNA5 at approximately 31 kDa. The expected band size for KCNA5 is at 31 kDa.
Click image to see more details
Figure 2. IHC analysis of KCNA5 using anti-KCNA5 antibody (PB9652).
KCNA5 was detected in a paraffin-embedded section of mouse brain tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-KCNA5 Antibody (PB9652) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of KCNA5 using anti-KCNA5 antibody (PB9652).
KCNA5 was detected in a paraffin-embedded section of human glioma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-KCNA5 Antibody (PB9652) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 4. IHC analysis of KCNA5 using anti-KCNA5 antibody (PB9652).
KCNA5 was detected in a paraffin-embedded section of rat brain tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-KCNA5 Antibody (PB9652) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 5. IF analysis of KChIP2 using anti-KChIP2 antibody (PB9652).
KChIP2 was detected in immunocytochemical section of SH-SY5Y cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 2μg/mL rabbit anti-KChIP2 Antibody (PB9652) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG (BA1127) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Click image to see more details
Figure 6. Flow Cytometry analysis of K562 cells using anti-KChIP2 antibody (PB9652).
Overlay histogram showing K562 cells stained with PB9652 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-KChIP2 Antibody (PB9652,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Protein Target Info & Infographic
Gene/Protein Information For KCNIP2 (Source: Uniprot.org, NCBI)
Gene Name
KCNIP2
Full Name
Kv channel-interacting protein 2
Weight
30.907kDa
Superfamily
recoverin family
Alternative Names
A-type potassium channel modulatory protein 2; cardiac voltage gated potassium channel modulatory subunit; Cardiac voltage-gated potassium channel modulatory subunit; DKFZp566L1246; KChIP2; KCHIP2Kv channel-interacting protein 2; Kv channel interacting protein 2; MGC17241; potassium channel interacting protein 2; Potassium channel-interacting protein 2 KCNIP2 KCHIP2 potassium voltage-gated channel interacting protein 2 Kv channel-interacting protein 2|A-type potassium channel modulatory protein 2|Kv channel interacting protein 2|cardiac voltage-gated potassium channel modulatory subunit|potassium channel-interacting protein 2
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on KCNIP2, check out the KCNIP2 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for KCNIP2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-KChIP2/KCNIP2 Antibody Picoband™ (PB9652)
Hello CJ!
No publications found for PB9652
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-KChIP2/KCNIP2 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
Be the first to review Anti-KChIP2/KCNIP2 Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
4 Customer Q&As for Anti-KChIP2/KCNIP2 Antibody Picoband™
Question
We need to test anti-KChIP2/KCNIP2 antibody PB9652 on rat skeletal muscle for research purposes, then I may be interested in using anti-KChIP2/KCNIP2 antibody PB9652 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
M. Johnson
Verified customer
Asked: 2019-01-03
Answer
The products we sell, including anti-KChIP2/KCNIP2 antibody PB9652, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-01-03
Question
We are currently using anti-KChIP2/KCNIP2 antibody PB9652 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on canine tissues as well?
Verified Customer
Verified customer
Asked: 2018-10-19
Answer
The anti-KChIP2/KCNIP2 antibody (PB9652) has not been tested for cross reactivity specifically with canine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in canine you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2018-10-19
Question
Is this PB9652 anti-KChIP2/KCNIP2 antibody reactive to the isotypes of KCNIP2?
P. Rodriguez
Verified customer
Asked: 2018-07-03
Answer
The immunogen of PB9652 anti-KChIP2/KCNIP2 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human KChIP2 (78-112aa DEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYR), different from the related mouse and rat sequences by one amino acid. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2018-07-03
Question
I was wanting to use your anti-KChIP2/KCNIP2 antibody for IHC for rat skeletal muscle on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for rat skeletal muscle identification?
L. Walker
Verified customer
Asked: 2014-10-29
Answer
You can see on the product datasheet, PB9652 anti-KChIP2/KCNIP2 antibody has been validated for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat skeletal muscle in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2014-10-29