Product Info Summary
SKU: | PB9586 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-liver FABP/FABP1 Antibody Picoband™
View all FABP1/L-FABP Antibodies
SKU/Catalog Number
PB9586
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-liver FABP/FABP1 Antibody Picoband™ catalog # PB9586. Tested in IHC, WB applications. This antibody reacts with Human, Monkey, Mouse, Rat, Chicken.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-liver FABP/FABP1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9586)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.01mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human liver FABP, different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9586 is reactive to FABP1 in Human, Mouse, Rat
Applications
PB9586 is guaranteed for IHC, WB Boster Guarantee
Observed Molecular Weight
14 kDa
Calculated molecular weight
14.208kDa
Background of FABP1/L-FABP
Fatty acid binding protein 1, liver, also known as FABP1 or FABPL, is a human gene locating at 2p11. FABP1 encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind free fatty acids, their CoA derivatives, bilirubin, organic anions, and other small molecules. FABP1 and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metaboism. The liver form of FABP may be identical to the major liver protein-1 (Lvp-1), which is encoded by a gene situated within 1 cM of Ly-2.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Monkey, Mouse, Rat, Chicken
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of liver FABP using anti-liver FABP antibody (PB9586).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human hepatocellular carcinoma tumor tissue (HCCT) lysates,
Lane 2: chicken liver tissue lysates,
Lane 3: monkey liver tissue lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-liver FABP antigen affinity purified polyclonal antibody (Catalog # PB9586) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for liver FABP at approximately 14 kDa. The expected band size for liver FABP is at 14 kDa.
Click image to see more details
Figure 2. IHC analysis of liver FABP using anti-liver FABP antibody (PB9586).
liver FABP was detected in a paraffin-embedded section of mouse intestine tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-liver FABP Antibody (PB9586) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of liver FABP using anti-liver FABP antibody (PB9586).
liver FABP was detected in a paraffin-embedded section of rat intestine tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-liver FABP Antibody (PB9586) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 4. IHC analysis of liver FABP using anti-liver FABP antibody (PB9586).
liver FABP was detected in a paraffin-embedded section of human intestinal cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-liver FABP Antibody (PB9586) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 5. Western blot analysis of liver FABP using anti-liver FABP antibody (PB9586).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: rat liver tissue lysates,
Lane 2: rat small intestine tissue lysates,
Lane 3: rat RH35 whole cell lysates,
Lane 4: rat PC-12 whole cell lysates,
Lane 5: mouse liver tissue lysates,
Lane 6: mouse small intestine tissue lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-liver FABP antigen affinity purified polyclonal antibody (Catalog # PB9586) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for liver FABP at approximately 14 kDa. The expected band size for liver FABP is at 14 kDa.
Protein Target Info & Infographic
Gene/Protein Information For FABP1 (Source: Uniprot.org, NCBI)
Gene Name
FABP1
Full Name
Fatty acid-binding protein, liver
Weight
14.208kDa
Superfamily
calycin superfamily
Alternative Names
FABP1; FABPL; fatty acid binding protein 1, liver; fatty acid-binding protein, liver; LFABP; L-FABP; L-FABPFatty acid-binding protein 1; Liver-type fatty acid-binding protein FABP1 FABPL, L-FABP fatty acid binding protein 1 fatty acid-binding protein, liver|fatty acid binding protein 1, liver|liver-type fatty acid-binding protein
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on FABP1, check out the FABP1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for FABP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-liver FABP/FABP1 Antibody Picoband™ (PB9586)
Hello CJ!
PB9586 has been cited in 3 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Elucidation of the mechanism of NEFA-induced PERK-eIF2α signaling pathway regulation of lipid metabolism in bovine hepatocytes
Huang Y,Zhao C,Kong Y,Tan P,Liu S,Liu Y,Zeng F,Yuan Y,Zhao B,Wang J.Elucidation of the mechanism of NEFA-induced PERK-eIF2α signaling pathway regulation of lipid metabolism in bovine hepatocytes.J Steroid Biochem Mol Biol.2021 Apr 2:105893.doi:10.101 6/j.jsbmb.2021.105893.Epub ahead of print.PMID:33819629.
Species: Holstein calves
PB9586 usage in article: APP:WB, SAMPLE:HEPATOCYTES, DILUTION:1:1000
Kong Y, Zhao C, Huang Y, Liu Y, Liu S, Guo Y, Li M, Xu T, Zhao B, Wang J. Angiopoietin-like protein 4 promotes very-low-density lipoprotein assembly and secretion in bovine hepatocytes in vitro. IUBMB Life. 2020 Nov 17. doi: 10.1002/iub.2403. Epub ahead o
Species: Calf
PB9586 usage in article: APP:WB, SAMPLE:HEPATOCYTES, DILUTION:NA
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-liver FABP/FABP1 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
Be the first to review Anti-liver FABP/FABP1 Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
7 Customer Q&As for Anti-liver FABP/FABP1 Antibody Picoband™
Question
Is this PB9586 anti-liver FABP/FABP1 antibody reactive to the isotypes of FABP1?
Verified Customer
Verified customer
Asked: 2020-02-07
Answer
The immunogen of PB9586 anti-liver FABP/FABP1 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human liver FABP (6-36aa KYQLQSQENFEAFMKAIGLPEELIQKGKDIK), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-02-07
Question
Is a blocking peptide available for product anti-liver FABP/FABP1 antibody (PB9586)?
Verified Customer
Verified customer
Asked: 2019-12-27
Answer
We do provide the blocking peptide for product anti-liver FABP/FABP1 antibody (PB9586). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-12-27
Question
Will anti-liver FABP/FABP1 antibody PB9586 work for IHC with colon?
Verified Customer
Verified customer
Asked: 2019-08-13
Answer
According to the expression profile of colon, FABP1 is highly expressed in colon. So, it is likely that anti-liver FABP/FABP1 antibody PB9586 will work for IHC with colon.
Boster Scientific Support
Answered: 2019-08-13
Question
We are currently using anti-liver FABP/FABP1 antibody PB9586 for rat tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on feline tissues as well?
A. Baker
Verified customer
Asked: 2019-07-25
Answer
The anti-liver FABP/FABP1 antibody (PB9586) has not been validated for cross reactivity specifically with feline tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-07-25
Question
Does PB9586 anti-liver FABP/FABP1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
F. Miller
Verified customer
Asked: 2019-07-24
Answer
As indicated on the product datasheet, PB9586 anti-liver FABP/FABP1 antibody as been validated on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-07-24
Question
Can you help my question with product PB9586, anti-liver FABP/FABP1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2018-08-01
Answer
We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9586 anti-liver FABP/FABP1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2018-08-01
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for colon using anti-liver FABP/FABP1 antibody PB9586. Let me know if you need anything else.
A. Thomas
Verified customer
Asked: 2017-04-14
Answer
Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2017-04-14