Product Info Summary
SKU: | A02207-1 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Rat |
Host: | Rabbit |
Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-MATH1/HATH1/ATOH1 Antibody Picoband™
SKU/Catalog Number
A02207-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-MATH1/HATH1/ATOH1 Antibody Picoband™ catalog # A02207-1. Tested in WB applications. This antibody reacts with Human, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-MATH1/HATH1/ATOH1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A02207-1)
Host
Rabbit
Contents
Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human MATH1/HATH1, different from the related mouse sequence by three amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A02207-1 is reactive to ATOH1 in Human, Rat
Applications
A02207-1 is guaranteed for WB Boster Guarantee
Observed Molecular Weight
38 kDa
Calculated molecular weight
38.16kDa
Background of MATH1
Protein atonal homolog 1 is a protein that in humans is encoded by the ATOH1 gene. This protein belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47. ATOH1 is required for the formation of both neural and non-neural cell types. Using genetic deletion in mice, Atoh1 has been shown to be essential for formation of cerebellar granule neurons, inner ear hair cells, spinal cord interneurons, Merkel cells of the skin, and intestinal secretory cells (goblet, enteroendocrine, and Paneth cells).
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Rat
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of MATH1/HATH1/ATOH1 using anti-MATH1/HATH1/ATOH1 antibody (A02207-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human HL-60 whole cell lysates,
Lane 2: rat PC-12 whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-MATH1/HATH1/ATOH1 antigen affinity purified polyclonal antibody (Catalog # A02207-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for MATH1/HATH1/ATOH1 at approximately 38 kDa. The expected band size for MATH1/HATH1/ATOH1 is at 38 kDa.
Protein Target Info & Infographic
Gene/Protein Information For ATOH1 (Source: Uniprot.org, NCBI)
Gene Name
ATOH1
Full Name
Protein atonal homolog 1
Weight
38.16kDa
Alternative Names
ATH1protein atonal homolog 1; atonal homolog 1 (Drosophila); BHLHA14; bHLHa14Math1; Class A basic helix-loop-helix protein 14; HATH1; Helix-loop-helix protein hATH-1; MATH-1 ATOH1 ATH1, HATH1, MATH-1, bHLHa14 atonal bHLH transcription factor 1 protein atonal homolog 1|atonal homolog 1|atonal homolog bHLH transcription factor 1|class A basic helix-loop-helix protein 14|helix-loop-helix protein hATH-1
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on ATOH1, check out the ATOH1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for ATOH1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-MATH1/HATH1/ATOH1 Antibody Picoband™ (A02207-1)
Hello CJ!
No publications found for A02207-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-MATH1/HATH1/ATOH1 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
Be the first to review Anti-MATH1/HATH1/ATOH1 Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
4 Customer Q&As for Anti-MATH1/HATH1/ATOH1 Antibody Picoband™
Question
Is this A02207-1 anti-MATH1/HATH1/ATOH1 antibody reactive to the isotypes of ATOH1?
S. Roberts
Verified customer
Asked: 2018-12-18
Answer
The immunogen of A02207-1 anti-MATH1/HATH1/ATOH1 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human MATH1/HATH1 (1-30aa MSRLLHAEEWAEVKELGDHHRQPQPHHLPQ), different from the related mouse sequence by three amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2018-12-18
Question
See attached the WB image, lot number and protocol we used for mucosa of transverse colon using anti-MATH1/HATH1/ATOH1 antibody A02207-1. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2018-12-03
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2018-12-03
Question
We are currently using anti-MATH1/HATH1/ATOH1 antibody A02207-1 for rat tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on feline tissues as well?
J. Zhao
Verified customer
Asked: 2013-11-04
Answer
The anti-MATH1/HATH1/ATOH1 antibody (A02207-1) has not been tested for cross reactivity specifically with feline tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2013-11-04
Question
I was wanting to use your anti-MATH1/HATH1/ATOH1 antibody for WB for rat mucosa of transverse colon on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for rat mucosa of transverse colon identification?
B. Lewis
Verified customer
Asked: 2013-01-02
Answer
You can see on the product datasheet, A02207-1 anti-MATH1/HATH1/ATOH1 antibody has been validated for WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat mucosa of transverse colon in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2013-01-02