Product Info Summary
SKU: | A01537-1 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-NFIB/NF1B2 Antibody Picoband™
SKU/Catalog Number
A01537-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-NFIB/NF1B2 Antibody Picoband™ catalog # A01537-1. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-NFIB/NF1B2 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01537-1)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human NFIB/NF1B2, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A01537-1 is reactive to NFIB in Human, Mouse, Rat
Applications
A01537-1 is guaranteed for IHC, WB Boster Guarantee
Observed Molecular Weight
50 kDa
Calculated molecular weight
47.442kDa
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of NFIB/NF1B2 using anti-NFIB/NF1B2 antibody (A01537-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human Hela whole cell lysates,
Lane 2: rat PC-12 whole cell lysates,
Lane 3: mouse lung tissue lysates,
Lane 4: mouse ovary tissue lysates,
Lane 5: mouse HEPA1-6 whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-NFIB/NF1B2 antigen affinity purified polyclonal antibody (Catalog # A01537-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for NFIB/NF1B2 at approximately 50KD. The expected band size for NFIB/NF1B2 is at 47KD.
Click image to see more details
Figure 2. IHC analysis of NFIB/NF1B2 using anti-NFIB/NF1B2 antibody (A01537-1).
NFIB/NF1B2 was detected in paraffin-embedded section of human mammary cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-NFIB/NF1B2 Antibody (A01537-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of NFIB/NF1B2 using anti-NFIB/NF1B2 antibody (A01537-1).
NFIB/NF1B2 was detected in paraffin-embedded section of mouse lung tissue . Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-NFIB/NF1B2 Antibody (A01537-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 4. IHC analysis of NFIB/NF1B2 using anti-NFIB/NF1B2 antibody (A01537-1).
NFIB/NF1B2 was detected in paraffin-embedded section of rat cardiac muscle tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-NFIB/NF1B2 Antibody (A01537-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Protein Target Info & Infographic
Gene/Protein Information For NFIB (Source: Uniprot.org, NCBI)
Gene Name
NFIB
Full Name
Nuclear factor 1 B-type
Weight
47.442kDa
Superfamily
CTF/NF-I family
Alternative Names
CCAAT-box-binding transcription factor; CTF; HMGIC/NFIB; NF-I/B; NFI-B; NFIB2; NFIB3; NFI-RED; nuclear factor 1 B-type; Nuclear factor 1/B; nuclear factor I/BNF1-B; TGGCA-binding protein NFIB CTF, HMGIC/NFIB, MACID, NF-I/B, NF1-B, NFI-B, NFI-RED2, NFIB3, NFIB nuclear factor I B nuclear factor 1 B-type|CCAAT-box-binding transcription factor|TGGCA-binding protein|nuclear factor 1/B
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on NFIB, check out the NFIB Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for NFIB: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-NFIB/NF1B2 Antibody Picoband™ (A01537-1)
Hello CJ!
No publications found for A01537-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-NFIB/NF1B2 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
Be the first to review Anti-NFIB/NF1B2 Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
6 Customer Q&As for Anti-NFIB/NF1B2 Antibody Picoband™
Question
Is this A01537-1 anti-NFIB/NF1B2 antibody reactive to the isotypes of NFIB?
Verified Customer
Verified customer
Asked: 2020-05-01
Answer
The immunogen of A01537-1 anti-NFIB/NF1B2 antibody is A synthetic peptide corresponding to a sequence of human NFIB/NF1B2 (ELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQR). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-05-01
Question
We are interested in to test anti-NFIB/NF1B2 antibody A01537-1 on rat foreskin for research purposes, then I may be interested in using anti-NFIB/NF1B2 antibody A01537-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2020-03-03
Answer
The products we sell, including anti-NFIB/NF1B2 antibody A01537-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2020-03-03
Question
Do you have a BSA free version of anti-NFIB/NF1B2 antibody A01537-1 available?
Verified Customer
Verified customer
Asked: 2020-02-12
Answer
Thanks for your recent telephone inquiry. I can confirm that some lots of this anti-NFIB/NF1B2 antibody A01537-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2020-02-12
Question
My question regarding product A01537-1, anti-NFIB/NF1B2 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2020-01-20
Answer
It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A01537-1 anti-NFIB/NF1B2 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2020-01-20
Question
Is a blocking peptide available for product anti-NFIB/NF1B2 antibody (A01537-1)?
Verified Customer
Verified customer
Asked: 2019-06-28
Answer
We do provide the blocking peptide for product anti-NFIB/NF1B2 antibody (A01537-1). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-06-28
Question
We are currently using anti-NFIB/NF1B2 antibody A01537-1 for human tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on bovine tissues as well?
Verified Customer
Verified customer
Asked: 2017-05-22
Answer
The anti-NFIB/NF1B2 antibody (A01537-1) has not been validated for cross reactivity specifically with bovine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in bovine you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2017-05-22