Product Info Summary
SKU: | PB9840 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | Flow Cytometry, IF, IHC, ICC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-PGP9.5/UCHL1 Antibody Picoband™
View all UCH-L1/PGP9.5 Antibodies
SKU/Catalog Number
PB9840
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-PGP9.5/UCHL1 Antibody Picoband™ catalog # PB9840. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-PGP9.5/UCHL1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9840)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human PGP9.5, different from the related mouse and rat sequences by two amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9840 is reactive to UCHL1 in Human, Mouse, Rat
Applications
PB9840 is guaranteed for Flow Cytometry, IF, IHC, ICC, WB Boster Guarantee
Observed Molecular Weight
25 kDa
Calculated molecular weight
24.824kDa
Background of UCH-L1/PGP9.5
UCH-L1, also known as PGP9.5, is a member of a gene family whose products hydrolyze small C-terminal adducts of ubiquitin to generate the ubiquitin monomer. Expression of UCH-L1 is highly specific to neurons and to cells of the diffuse neuroendocrine system and their tumors. It is abundantly present in all neurons (accounts for 1-2% of total brain protein), expressed specifically in neurons and testis/ovary. The catalytic triad of UCH-L1 contains a cysteine at position 90, an aspartate at position 176, and a histidine at position 161 that are responsible for its hydrolase activity.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
Flow Cytometry, 1-3μg/1x106 cells, Human
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of PGP9.5 using anti-PGP9.5 antibody (PB9840).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human U87 whole cell lysates,
Lane 2: human SH-SY5Y whole cell lysates,
Lane 3: rat brain tissue lysates,
Lane 4: rat C6 whole cell lysates,
Lane 3: mouse brain tissue lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-PGP9.5 antigen affinity purified polyclonal antibody (Catalog # PB9840) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for PGP9.5 at approximately 25 kDa. The expected band size for PGP9.5 is at 25 kDa.
Click image to see more details
Figure 2. IHC analysis of PGP9.5 using anti-PGP9.5 antibody (PB9840).
PGP9.5 was detected in a paraffin-embedded section of mouse brain tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-PGP9.5 Antibody (PB9840) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of PGP9.5 using anti-PGP9.5 antibody (PB9840).
PGP9.5 was detected in a paraffin-embedded section of rat brain tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-PGP9.5 Antibody (PB9840) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 4. IHC analysis of PGP9.5 using anti-PGP9.5 antibody (PB9840).
PGP9.5 was detected in a paraffin-embedded section of human glioma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-PGP9.5 Antibody (PB9840) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 5. IF analysis of PGP9.5 using anti-PGP9.5 antibody (PB9840).
PGP9.5 was detected in immunocytochemical section of SH-SY5Y cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 2μg/mL rabbit anti-PGP9.5 Antibody (PB9840) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG (BA1127) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Click image to see more details
Figure 6. Flow Cytometry analysis of K562 cells using anti-PGP9.5 antibody (PB9840).
Overlay histogram showing K562 cells stained with PB9840 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PGP9.5 Antibody (PB9840,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Protein Target Info & Infographic
Gene/Protein Information For UCHL1 (Source: Uniprot.org, NCBI)
Gene Name
UCHL1
Full Name
Ubiquitin carboxyl-terminal hydrolase isozyme L1
Weight
24.824kDa
Superfamily
peptidase C12 family
Alternative Names
EC 3.4.19.12; EC 6.-; Neuron cytoplasmic protein 9.5; PARK5; PGP 9.5; PGP9.5; PGP9.5Uch-L1; PGP95; ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase); ubiquitin carboxyl-terminal hydrolase isozyme L1; ubiquitin C-terminal hydrolase; Ubiquitin thioesterase L1; UCHL1; UCH-L1 UCHL1 HEL-117, HEL-S-53, NDGOA, PARK5, PGP 9.5, PGP9.5, PGP95, SPG79, Uch-L1 ubiquitin C-terminal hydrolase L1 ubiquitin carboxyl-terminal hydrolase isozyme L1|epididymis luminal protein 117|epididymis secretory protein Li 53|neuron cytoplasmic protein 9.5|ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase)|ubiquitin thioesterase L1|ubiquitin thiolesterase
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on UCHL1, check out the UCHL1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for UCHL1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-PGP9.5/UCHL1 Antibody Picoband™ (PB9840)
Hello CJ!
PB9840 has been cited in 3 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Zhu WQ,Cai NN,Jiang Y,Yang R,Shi JZ,Zhu CL,Zhang BY,Tang B,Zhang XM.Survivable potential of germ cells after trehalose cryopreservation of bovine testicular tissues.Cryobiology.2021 May 11:S0011-2240(21)00081-X.doi:10.1016/j.cryobiol.2021.05.001.Epub ahead of print.PMID:33989617.
Species: Bull
PB9840 usage in article: APP:IF, SAMPLE:TESTICULAR TISSUE, DILUTION:1:2000
Age-associated changes of the intrinsic nervous system in relation with interstitial cells in the pre-weaning goat rumen Yu Liang,1 Imran Tarique,1 Waseem Ail Vistro,1 Yifei Liu,1 Ziyu Wang,2 Abdul haseeb,1 Noor Samad Gandahi,1 Adeela Iqbal,1 Siyi Wang,
Nude mice multi-drug resistance model of orthotopic transplantation of liver neoplasm and Tc-99m MIBI SPECT on p-glycoprotein
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-PGP9.5/UCHL1 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
Be the first to review Anti-PGP9.5/UCHL1 Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
17 Customer Q&As for Anti-PGP9.5/UCHL1 Antibody Picoband™
Question
Would anti-PGP9.5/UCHL1 antibody PB9840 work on pig WB with cajal-retzius cell fetal brain cortex?
W. Miller
Verified customer
Asked: 2020-04-09
Answer
Our lab technicians have not validated anti-PGP9.5/UCHL1 antibody PB9840 on pig. You can run a BLAST between pig and the immunogen sequence of anti-PGP9.5/UCHL1 antibody PB9840 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated pig samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in pig cajal-retzius cell fetal brain cortex in WB, you can get your next antibody for free.
Boster Scientific Support
Answered: 2020-04-09
Question
Would PB9840 anti-PGP9.5/UCHL1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2020-03-18
Answer
It shows on the product datasheet, PB9840 anti-PGP9.5/UCHL1 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2020-03-18
Question
I see that the anti-PGP9.5/UCHL1 antibody PB9840 works with WB, what is the protocol used to produce the result images on the product page?
G. Baker
Verified customer
Asked: 2020-03-09
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2020-03-09
Question
We have observed staining in human lung muscle. Do you have any suggestions? Is anti-PGP9.5/UCHL1 antibody supposed to stain lung muscle positively?
Verified Customer
Verified customer
Asked: 2020-02-21
Answer
From literature lung muscle does express UCHL1. From Uniprot.org, UCHL1 is expressed in anterior cingulate cortex, lung muscle, brain, cajal-retzius cell fetal brain cortex, among other tissues. Regarding which tissues have UCHL1 expression, here are a few articles citing expression in various tissues:
Brain, Cajal-Retzius cell, and Fetal brain cortex, Pubmed ID: 2947814
Lung, and Muscle, Pubmed ID: 15489334
Boster Scientific Support
Answered: 2020-02-21
Question
We ordered your anti-PGP9.5/UCHL1 antibody for IHC on anterior cingulate cortex a few years ago. I am using mouse, and We intend to use the antibody for WB next. I am interested in examining anterior cingulate cortex as well as brain in our next experiment. Could give a recommendation on which antibody would work the best for WB?
Verified Customer
Verified customer
Asked: 2019-12-24
Answer
I have checked the website and datasheets of our anti-PGP9.5/UCHL1 antibody and it seems that PB9840 has been validated on mouse in both IHC and WB. Thus PB9840 should work for your application. Our Boster satisfaction guarantee will cover this product for WB in mouse even if the specific tissue type has not been validated. We do have a comprehensive range of products for WB detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2019-12-24
Question
Our team were content with the WB result of your anti-PGP9.5/UCHL1 antibody. However we have seen positive staining in anterior cingulate cortex cytoplasm. using this antibody. Is that expected? Could you tell me where is UCHL1 supposed to be expressed?
Verified Customer
Verified customer
Asked: 2019-12-12
Answer
From literature, anterior cingulate cortex does express UCHL1. Generally UCHL1 expresses in cytoplasm. Regarding which tissues have UCHL1 expression, here are a few articles citing expression in various tissues:
Brain, Cajal-Retzius cell, and Fetal brain cortex, Pubmed ID: 2947814
Lung, and Muscle, Pubmed ID: 15489334
Boster Scientific Support
Answered: 2019-12-12
Question
Is a blocking peptide available for product anti-PGP9.5/UCHL1 antibody (PB9840)?
Verified Customer
Verified customer
Asked: 2019-10-30
Answer
We do provide the blocking peptide for product anti-PGP9.5/UCHL1 antibody (PB9840). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-10-30
Question
Is there a BSA free version of anti-PGP9.5/UCHL1 antibody PB9840 available?
Verified Customer
Verified customer
Asked: 2019-10-14
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-PGP9.5/UCHL1 antibody PB9840 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2019-10-14
Question
I was wanting to use your anti-PGP9.5/UCHL1 antibody for WB for mouse lung muscle on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse lung muscle identification?
Verified Customer
Verified customer
Asked: 2019-10-10
Answer
You can see on the product datasheet, PB9840 anti-PGP9.5/UCHL1 antibody has been tested for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse lung muscle in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-10-10
Question
Is this PB9840 anti-PGP9.5/UCHL1 antibody reactive to the isotypes of UCHL1?
Verified Customer
Verified customer
Asked: 2019-09-11
Answer
The immunogen of PB9840 anti-PGP9.5/UCHL1 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human PGP9.5 (120-153aa ETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCR), different from the related mouse and rat sequences by two amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-09-11
Question
Please see the WB image, lot number and protocol we used for lung muscle using anti-PGP9.5/UCHL1 antibody PB9840. Please let me know if you require anything else.
S. Walker
Verified customer
Asked: 2019-06-03
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-06-03
Question
I was wanting to use using your anti-PGP9.5/UCHL1 antibody for adult walking behavior studies. Has this antibody been tested with western blotting on tissue lysate? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2019-05-27
Answer
We appreciate your inquiry. This PB9840 anti-PGP9.5/UCHL1 antibody is tested on rat brain tissue, tissue lysate, mouse brain, u87 whole cell lysate, human glioma tissue. It is guaranteed to work for IHC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2019-05-27
Question
Does anti-PGP9.5/UCHL1 antibody PB9840 work for WB with lung muscle?
Verified Customer
Verified customer
Asked: 2019-05-17
Answer
According to the expression profile of lung muscle, UCHL1 is highly expressed in lung muscle. So, it is likely that anti-PGP9.5/UCHL1 antibody PB9840 will work for WB with lung muscle.
Boster Scientific Support
Answered: 2019-05-17
Question
Our lab want to know about to test anti-PGP9.5/UCHL1 antibody PB9840 on mouse lung muscle for research purposes, then I may be interested in using anti-PGP9.5/UCHL1 antibody PB9840 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-04-03
Answer
The products we sell, including anti-PGP9.5/UCHL1 antibody PB9840, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-04-03
Question
My question regarding product PB9840, anti-PGP9.5/UCHL1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2018-11-16
Answer
It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9840 anti-PGP9.5/UCHL1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2018-11-16
Question
We are currently using anti-PGP9.5/UCHL1 antibody PB9840 for mouse tissue, and we are satisfied with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on goat tissues as well?
E. Miller
Verified customer
Asked: 2018-04-19
Answer
The anti-PGP9.5/UCHL1 antibody (PB9840) has not been tested for cross reactivity specifically with goat tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2018-04-19
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for lung muscle using anti-PGP9.5/UCHL1 antibody PB9840. Let me know if you need anything else.
T. Rodriguez
Verified customer
Asked: 2016-01-05
Answer
We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2016-01-05