Anti-PGP9.5/UCHL1 Antibody Picoband™

UCH-L1/PGP9.5 antibody

Boster Bio Anti-PGP9.5/UCHL1 Antibody Picoband™ catalog # PB9840. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. Cited in 3 publication(s).

Product Info Summary

SKU: PB9840
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IF, IHC, ICC, WB

Product Name

Anti-PGP9.5/UCHL1 Antibody Picoband™

View all UCH-L1/PGP9.5 Antibodies

SKU/Catalog Number

PB9840

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-PGP9.5/UCHL1 Antibody Picoband™ catalog # PB9840. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-PGP9.5/UCHL1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9840)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human PGP9.5, different from the related mouse and rat sequences by two amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9840 is reactive to UCHL1 in Human, Mouse, Rat

Applications

PB9840 is guaranteed for Flow Cytometry, IF, IHC, ICC, WB Boster Guarantee

Observed Molecular Weight

25 kDa

Calculated molecular weight

24.824kDa

Background of UCH-L1/PGP9.5

UCH-L1, also known as PGP9.5, is a member of a gene family whose products hydrolyze small C-terminal adducts of ubiquitin to generate the ubiquitin monomer. Expression of UCH-L1 is highly specific to neurons and to cells of the diffuse neuroendocrine system and their tumors. It is abundantly present in all neurons (accounts for 1-2% of total brain protein), expressed specifically in neurons and testis/ovary. The catalytic triad of UCH-L1 contains a cysteine at position 90, an aspartate at position 176, and a histidine at position 161 that are responsible for its hydrolase activity.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
Flow Cytometry, 1-3μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For UCHL1 (Source: Uniprot.org, NCBI)

Gene Name

UCHL1

Full Name

Ubiquitin carboxyl-terminal hydrolase isozyme L1

Weight

24.824kDa

Superfamily

peptidase C12 family

Alternative Names

EC 3.4.19.12; EC 6.-; Neuron cytoplasmic protein 9.5; PARK5; PGP 9.5; PGP9.5; PGP9.5Uch-L1; PGP95; ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase); ubiquitin carboxyl-terminal hydrolase isozyme L1; ubiquitin C-terminal hydrolase; Ubiquitin thioesterase L1; UCHL1; UCH-L1 UCHL1 HEL-117, HEL-S-53, NDGOA, PARK5, PGP 9.5, PGP9.5, PGP95, SPG79, Uch-L1 ubiquitin C-terminal hydrolase L1 ubiquitin carboxyl-terminal hydrolase isozyme L1|epididymis luminal protein 117|epididymis secretory protein Li 53|neuron cytoplasmic protein 9.5|ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase)|ubiquitin thioesterase L1|ubiquitin thiolesterase

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on UCHL1, check out the UCHL1 Infographic

UCHL1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for UCHL1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

PB9840 has been cited in 3 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Zhu WQ,Cai NN,Jiang Y,Yang R,Shi JZ,Zhu CL,Zhang BY,Tang B,Zhang XM.Survivable potential of germ cells after trehalose cryopreservation of bovine testicular tissues.Cryobiology.2021 May 11:S0011-2240(21)00081-X.doi:10.1016/j.cryobiol.2021.05.001.Epub ahead of print.PMID:33989617.
Species: Bull
PB9840 usage in article: APP:IF, SAMPLE:TESTICULAR TISSUE, DILUTION:1:2000

Age-associated changes of the intrinsic nervous system in relation with interstitial cells in the pre-weaning goat rumen Yu Liang,1 Imran Tarique,1 Waseem Ail Vistro,1 Yifei Liu,1 Ziyu Wang,2 Abdul haseeb,1 Noor Samad Gandahi,1 Adeela Iqbal,1 Siyi Wang,

Nude mice multi-drug resistance model of orthotopic transplantation of liver neoplasm and Tc-99m MIBI SPECT on p-glycoprotein

Have you used Anti-PGP9.5/UCHL1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review Anti-PGP9.5/UCHL1 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

17 Customer Q&As for Anti-PGP9.5/UCHL1 Antibody Picoband™

Question

Would anti-PGP9.5/UCHL1 antibody PB9840 work on pig WB with cajal-retzius cell fetal brain cortex?

W. Miller

Verified customer

Asked: 2020-04-09

Answer

Our lab technicians have not validated anti-PGP9.5/UCHL1 antibody PB9840 on pig. You can run a BLAST between pig and the immunogen sequence of anti-PGP9.5/UCHL1 antibody PB9840 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated pig samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in pig cajal-retzius cell fetal brain cortex in WB, you can get your next antibody for free.

Boster Scientific Support

Answered: 2020-04-09

Question

Would PB9840 anti-PGP9.5/UCHL1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2020-03-18

Answer

It shows on the product datasheet, PB9840 anti-PGP9.5/UCHL1 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2020-03-18

Question

I see that the anti-PGP9.5/UCHL1 antibody PB9840 works with WB, what is the protocol used to produce the result images on the product page?

G. Baker

Verified customer

Asked: 2020-03-09

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2020-03-09

Question

We have observed staining in human lung muscle. Do you have any suggestions? Is anti-PGP9.5/UCHL1 antibody supposed to stain lung muscle positively?

Verified Customer

Verified customer

Asked: 2020-02-21

Answer

From literature lung muscle does express UCHL1. From Uniprot.org, UCHL1 is expressed in anterior cingulate cortex, lung muscle, brain, cajal-retzius cell fetal brain cortex, among other tissues. Regarding which tissues have UCHL1 expression, here are a few articles citing expression in various tissues:
Brain, Cajal-Retzius cell, and Fetal brain cortex, Pubmed ID: 2947814
Lung, and Muscle, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2020-02-21

Question

We ordered your anti-PGP9.5/UCHL1 antibody for IHC on anterior cingulate cortex a few years ago. I am using mouse, and We intend to use the antibody for WB next. I am interested in examining anterior cingulate cortex as well as brain in our next experiment. Could give a recommendation on which antibody would work the best for WB?

Verified Customer

Verified customer

Asked: 2019-12-24

Answer

I have checked the website and datasheets of our anti-PGP9.5/UCHL1 antibody and it seems that PB9840 has been validated on mouse in both IHC and WB. Thus PB9840 should work for your application. Our Boster satisfaction guarantee will cover this product for WB in mouse even if the specific tissue type has not been validated. We do have a comprehensive range of products for WB detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2019-12-24

Question

Our team were content with the WB result of your anti-PGP9.5/UCHL1 antibody. However we have seen positive staining in anterior cingulate cortex cytoplasm. using this antibody. Is that expected? Could you tell me where is UCHL1 supposed to be expressed?

Verified Customer

Verified customer

Asked: 2019-12-12

Answer

From literature, anterior cingulate cortex does express UCHL1. Generally UCHL1 expresses in cytoplasm. Regarding which tissues have UCHL1 expression, here are a few articles citing expression in various tissues:
Brain, Cajal-Retzius cell, and Fetal brain cortex, Pubmed ID: 2947814
Lung, and Muscle, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2019-12-12

Question

Is a blocking peptide available for product anti-PGP9.5/UCHL1 antibody (PB9840)?

Verified Customer

Verified customer

Asked: 2019-10-30

Answer

We do provide the blocking peptide for product anti-PGP9.5/UCHL1 antibody (PB9840). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-10-30

Question

Is there a BSA free version of anti-PGP9.5/UCHL1 antibody PB9840 available?

Verified Customer

Verified customer

Asked: 2019-10-14

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-PGP9.5/UCHL1 antibody PB9840 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-10-14

Question

I was wanting to use your anti-PGP9.5/UCHL1 antibody for WB for mouse lung muscle on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse lung muscle identification?

Verified Customer

Verified customer

Asked: 2019-10-10

Answer

You can see on the product datasheet, PB9840 anti-PGP9.5/UCHL1 antibody has been tested for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse lung muscle in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-10-10

Question

Is this PB9840 anti-PGP9.5/UCHL1 antibody reactive to the isotypes of UCHL1?

Verified Customer

Verified customer

Asked: 2019-09-11

Answer

The immunogen of PB9840 anti-PGP9.5/UCHL1 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human PGP9.5 (120-153aa ETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCR), different from the related mouse and rat sequences by two amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-09-11

Question

Please see the WB image, lot number and protocol we used for lung muscle using anti-PGP9.5/UCHL1 antibody PB9840. Please let me know if you require anything else.

S. Walker

Verified customer

Asked: 2019-06-03

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-06-03

Question

I was wanting to use using your anti-PGP9.5/UCHL1 antibody for adult walking behavior studies. Has this antibody been tested with western blotting on tissue lysate? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2019-05-27

Answer

We appreciate your inquiry. This PB9840 anti-PGP9.5/UCHL1 antibody is tested on rat brain tissue, tissue lysate, mouse brain, u87 whole cell lysate, human glioma tissue. It is guaranteed to work for IHC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2019-05-27

Question

Does anti-PGP9.5/UCHL1 antibody PB9840 work for WB with lung muscle?

Verified Customer

Verified customer

Asked: 2019-05-17

Answer

According to the expression profile of lung muscle, UCHL1 is highly expressed in lung muscle. So, it is likely that anti-PGP9.5/UCHL1 antibody PB9840 will work for WB with lung muscle.

Boster Scientific Support

Answered: 2019-05-17

Question

Our lab want to know about to test anti-PGP9.5/UCHL1 antibody PB9840 on mouse lung muscle for research purposes, then I may be interested in using anti-PGP9.5/UCHL1 antibody PB9840 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-04-03

Answer

The products we sell, including anti-PGP9.5/UCHL1 antibody PB9840, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-04-03

Question

My question regarding product PB9840, anti-PGP9.5/UCHL1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2018-11-16

Answer

It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9840 anti-PGP9.5/UCHL1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2018-11-16

Question

We are currently using anti-PGP9.5/UCHL1 antibody PB9840 for mouse tissue, and we are satisfied with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on goat tissues as well?

E. Miller

Verified customer

Asked: 2018-04-19

Answer

The anti-PGP9.5/UCHL1 antibody (PB9840) has not been tested for cross reactivity specifically with goat tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2018-04-19

Question

We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for lung muscle using anti-PGP9.5/UCHL1 antibody PB9840. Let me know if you need anything else.

T. Rodriguez

Verified customer

Asked: 2016-01-05

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2016-01-05

Order DetailsPrice
PB9840

100μg

$370
PB9840-10ug

10μg sample (liquid)

$99
PB9840-Biotin

100 μg Biotin conjugated

$570
PB9840-Cy3

100 μg Cy3 conjugated

$570
PB9840-Dylight488

100 μg Dylight488 conjugated

$570
PB9840-Dylight550

100 μg Dylight550 conjugated

$570
PB9840-Dylight594

100 μg Dylight594 conjugated

$570
PB9840-FITC

100 μg FITC conjugated

$570
PB9840-HRP

100 μg HRP conjugated

$570
PB9840-APC

100 μg APC conjugated

$670
PB9840-PE

100 μg PE conjugated

$670
PB9840-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9840
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.