Product Info Summary
SKU: | A02153-2 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human |
Host: | Rabbit |
Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Prostaglandin E Receptor EP4/PTGER4 Antibody Picoband™
View all PTGER4/EP4 Antibodies
SKU/Catalog Number
A02153-2
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Prostaglandin E Receptor EP4/PTGER4 Antibody Picoband™ catalog # A02153-2. Tested in WB applications. This antibody reacts with Human.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Prostaglandin E Receptor EP4/PTGER4 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A02153-2)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human PTGER4, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A02153-2 is reactive to PTGER4 in Human
Applications
A02153-2 is guaranteed for WB Boster Guarantee
Observed Molecular Weight
53 kDa
Calculated molecular weight
53.119kDa
Background of PTGER4/EP4
Prostaglandin E2 receptor 4 (EP4) is a prostaglandin receptor encoded by the PTGER4 gene in humans. The protein encoded by this gene is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor can activate T-cell factor signaling. It has been shown to mediate PGE2 induced expression of early growth response 1 (EGR1), regulate the level and stability of cyclooxygenase-2 mRNA, and lead to the phosphorylation of glycogen synthase kinase-3. Knockout studies in mice suggest that this receptor may be involved in the neonatal adaptation of circulatory system, osteoporosis, as well as initiation of skin immune responses.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of PTGER4 using anti-PTGER4 antibody (A02153-2).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: SW620 whole Cell lysates,
Lane 2: MCF-7 whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-PTGER4 antigen affinity purified polyclonal antibody (Catalog # A02153-2) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for PTGER4 at approximately 53KD. The expected band size for PTGER4 is at 53KD.
Protein Target Info & Infographic
Gene/Protein Information For PTGER4 (Source: Uniprot.org, NCBI)
Gene Name
PTGER4
Full Name
Prostaglandin E2 receptor EP4 subtype
Weight
53.119kDa
Superfamily
G-protein coupled receptor 1 family
Alternative Names
EP4; EP4R; MGC126583; PGE receptor EP4 subtype; PGE receptor, EP4 subtype; PGE2 receptor EP4 subtype; prostaglandin E receptor 4 (subtype EP4); prostaglandin E2 receptor EP4 subtype; Prostanoid EP4 receptor; PTGER2; PTGER4 PTGER4 EP4, EP4R prostaglandin E receptor 4 prostaglandin E2 receptor EP4 subtype|PGE receptor, EP4 subtype|PGE2 receptor EP4 subtype|prostaglandin E receptor 4 (subtype EP4)|prostanoid EP4 receptor
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on PTGER4, check out the PTGER4 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for PTGER4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Prostaglandin E Receptor EP4/PTGER4 Antibody Picoband™ (A02153-2)
Hello CJ!
No publications found for A02153-2
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Prostaglandin E Receptor EP4/PTGER4 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
Be the first to review Anti-Prostaglandin E Receptor EP4/PTGER4 Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
7 Customer Q&As for Anti-Prostaglandin E Receptor EP4/PTGER4 Antibody Picoband™
Question
Does anti-Prostaglandin E Receptor EP4/PTGER4 antibody A02153-2 work for WB with lung?
Verified Customer
Verified customer
Asked: 2020-04-23
Answer
According to the expression profile of lung, PTGER4 is highly expressed in lung. So, it is likely that anti-Prostaglandin E Receptor EP4/PTGER4 antibody A02153-2 will work for WB with lung.
Boster Scientific Support
Answered: 2020-04-23
Question
Is this A02153-2 anti-Prostaglandin E Receptor EP4/PTGER4 antibody reactive to the isotypes of PTGER4?
Verified Customer
Verified customer
Asked: 2020-04-06
Answer
The immunogen of A02153-2 anti-Prostaglandin E Receptor EP4/PTGER4 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human PTGER4 (311-345aa DLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIK), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-04-06
Question
I was wanting to use your anti-Prostaglandin E Receptor EP4/PTGER4 antibody for WB for human lung on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human lung identification?
Verified Customer
Verified customer
Asked: 2019-12-17
Answer
It shows on the product datasheet, A02153-2 anti-Prostaglandin E Receptor EP4/PTGER4 antibody has been tested for WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human lung in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-12-17
Question
Would anti-Prostaglandin E Receptor EP4/PTGER4 antibody A02153-2 work on feline WB with metanephric glomerulus?
Verified Customer
Verified customer
Asked: 2019-10-03
Answer
Our lab technicians have not validated anti-Prostaglandin E Receptor EP4/PTGER4 antibody A02153-2 on feline. You can run a BLAST between feline and the immunogen sequence of anti-Prostaglandin E Receptor EP4/PTGER4 antibody A02153-2 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated feline samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in feline metanephric glomerulus in WB, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-10-03
Question
We are currently using anti-Prostaglandin E Receptor EP4/PTGER4 antibody A02153-2 for human tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human. Is it possible that the antibody can work on goat tissues as well?
Verified Customer
Verified customer
Asked: 2019-05-13
Answer
The anti-Prostaglandin E Receptor EP4/PTGER4 antibody (A02153-2) has not been validated for cross reactivity specifically with goat tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-05-13
Question
Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for lung using anti-Prostaglandin E Receptor EP4/PTGER4 antibody A02153-2. Let me know if you need anything else.
N. Huang
Verified customer
Asked: 2016-06-15
Answer
I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2016-06-15
Question
Would A02153-2 anti-Prostaglandin E Receptor EP4/PTGER4 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
J. Wu
Verified customer
Asked: 2014-12-22
Answer
It shows on the product datasheet, A02153-2 anti-Prostaglandin E Receptor EP4/PTGER4 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2014-12-22