Anti-SLC26A4 Antibody Picoband®

SLC26A4 antibody

Boster Bio Anti-SLC26A4 Antibody Picoband® catalog # A00919-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Product Info Summary

SKU: A00919-1
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: WB

Customers Who Bought This Also Bought

Product Name

Anti-SLC26A4 Antibody Picoband®

View all SLC26A4 Antibodies

SKU/Catalog Number

A00919-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-SLC26A4 Antibody Picoband® catalog # A00919-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-SLC26A4 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00919-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human SLC26A4, which shares 84.4% amino acid (aa) sequence identity with both mouse and rat SCNN1A.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A00919-1 is reactive to SLC26A4 in Human, Mouse, Rat

Observed Molecular Weight

86 kDa

Calculated molecular weight

85.7 kDa

Background of SLC26A4

Pendrin, is an anion exchange protein that in humans is encoded by the SLC26A4 gene. Pendrin is an ion exchanger found in many types of cells in the body. High levels of pendrin expression have been identified in the inner ear and thyroid. In the thyroid, pendrin mediates a component of the efflux of iodide across the apical membrane of the thyrocyte, which is critical for the formation of thyroid hormone. The exact function of pendrin in the inner ear remains unclear; however, pendrin may play a role in acid-base balance as a chloride-bicarbonate exchanger, regulate volume homeostasis through its ability to function as a chloride-formate exchanger or indirectly modulate the calcium concentration of the endolymph.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A00919-1 is guaranteed for WB Boster Guarantee

Recommend Dilution

ApplicationDilutionSpecies
Western blot0.1-0.5μg/ml

Tested application

SLC26A4 antibody was positively detected by WB in:
human HK-2 whole cell, human 293T whole cell
Suggested blocking solution with 5% non-fat milk or BSA; (*)Recommended protein loading: 20-40 µg per lane

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-SLC26A4 Antibody Picoband®?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

0 Reviews For Anti-SLC26A4 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

3 Customer Q&As for Anti-SLC26A4 Antibody Picoband®

Question

Is this A00919-1 anti-SLC26A4 antibody reactive to the isotypes of SLC26A4?

D. Jones

Verified customer

Asked: 2019-10-10

Answer

The immunogen of A00919-1 anti-SLC26A4 antibody is A synthetic peptide corresponding to a sequence of human SLC26A4 (RSLRVIVKEFQRIDVNVYFASLQDYVIEKLEQ). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-10-10

Question

Is there a BSA free version of anti-SLC26A4 antibody A00919-1 available?

Verified Customer

Verified customer

Asked: 2018-12-26

Answer

Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-SLC26A4 antibody A00919-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2018-12-26

Question

We are currently using anti-SLC26A4 antibody A00919-1 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on pig tissues as well?

O. Jha

Verified customer

Asked: 2016-04-14

Answer

The anti-SLC26A4 antibody (A00919-1) has not been tested for cross reactivity specifically with pig tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2016-04-14

Order DetailsPrice
A00919-1

100μg

$370
A00919-1-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
A00919-1-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
A00919-1-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
A00919-1-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
A00919-1-APC

100 μg APC conjugated (liquid)

$820
A00919-1-FITC

100 μg FITC conjugated (liquid)

$570
A00919-1-Cy3

100 μg Cy3 conjugated (liquid)

$570
A00919-1-Biotin

100 μg Biotin conjugated (liquid)

$570
A00919-1-HRP

100 μg HRP conjugated (liquid)

$570
A00919-1-PE

100 μg PE conjugated (liquid)

$820
A00919-1-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
A00919-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: Sep 7, 2026