Anti-SLC26A4 Antibody Picoband™

SLC26A4 antibody

Boster Bio Anti-SLC26A4 Antibody Picoband™ catalog # A00919-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A00919-1
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: WB

Product Name

Anti-SLC26A4 Antibody Picoband™

View all SLC26A4 Antibodies

SKU/Catalog Number

A00919-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-SLC26A4 Antibody Picoband™ catalog # A00919-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-SLC26A4 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00919-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human SLC26A4, which shares 84.4% amino acid (aa) sequence identity with both mouse and rat SCNN1A.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A00919-1 is reactive to SLC26A4 in Human, Mouse, Rat

Applications

A00919-1 is guaranteed for WB Boster Guarantee

Observed Molecular Weight

86 kDa

Calculated molecular weight

85.723kDa

Background of SLC26A4

Pendrin, is an anion exchange protein that in humans is encoded by the SLC26A4 gene. Pendrin is an ion exchanger found in many types of cells in the body. High levels of pendrin expression have been identified in the inner ear and thyroid. In the thyroid, pendrin mediates a component of the efflux of iodide across the apical membrane of the thyrocyte, which is critical for the formation of thyroid hormone. The exact function of pendrin in the inner ear remains unclear; however, pendrin may play a role in acid-base balance as a chloride-bicarbonate exchanger, regulate volume homeostasis through its ability to function as a chloride-formate exchanger or indirectly modulate the calcium concentration of the endolymph.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml

Validation Images & Assay Conditions

Gene/Protein Information For SLC26A4 (Source: Uniprot.org, NCBI)

Gene Name

SLC26A4

Full Name

Pendrin

Weight

85.723kDa

Superfamily

SLC26A/SulP transporter (TC 2.A.53) family

Alternative Names

DFNB4; EVA; PDSTDH2B; pendrin; Sodium-independent chloride/iodide transporter; Solute carrier family 26 member 4; solute carrier family 26, member 4 SLC26A4 DFNB4, EVA, PDS, TDH2B solute carrier family 26 member 4 pendrin|sodium-independent chloride/iodide transporter|solute carrier family 26 (anion exchanger), member 4|truncated solute carrier family 26

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on SLC26A4, check out the SLC26A4 Infographic

SLC26A4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SLC26A4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A00919-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-SLC26A4 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review Anti-SLC26A4 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

3 Customer Q&As for Anti-SLC26A4 Antibody Picoband™

Question

Is this A00919-1 anti-SLC26A4 antibody reactive to the isotypes of SLC26A4?

D. Jones

Verified customer

Asked: 2019-10-10

Answer

The immunogen of A00919-1 anti-SLC26A4 antibody is A synthetic peptide corresponding to a sequence of human SLC26A4 (RSLRVIVKEFQRIDVNVYFASLQDYVIEKLEQ). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-10-10

Question

Is there a BSA free version of anti-SLC26A4 antibody A00919-1 available?

Verified Customer

Verified customer

Asked: 2018-12-26

Answer

Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-SLC26A4 antibody A00919-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2018-12-26

Question

We are currently using anti-SLC26A4 antibody A00919-1 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on pig tissues as well?

O. Jha

Verified customer

Asked: 2016-04-14

Answer

The anti-SLC26A4 antibody (A00919-1) has not been tested for cross reactivity specifically with pig tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2016-04-14

Order DetailsPrice
A00919-1

100μg

$370
A00919-1-10ug

10μg sample (liquid)

$99
A00919-1-Biotin

100 μg Biotin conjugated

$570
A00919-1-Cy3

100 μg Cy3 conjugated

$570
A00919-1-Dylight488

100 μg Dylight488 conjugated

$570
A00919-1-Dylight550

100 μg Dylight550 conjugated

$570
A00919-1-Dylight594

100 μg Dylight594 conjugated

$570
A00919-1-FITC

100 μg FITC conjugated

$570
A00919-1-HRP

100 μg HRP conjugated

$570
A00919-1-APC

100 μg APC conjugated

$670
A00919-1-PE

100 μg PE conjugated

$670
A00919-1-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A00919-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.