Anti-TNF alpha Antibody Picoband™

TNF-alpha antibody

Boster Bio Anti-TNF alpha Antibody Picoband™ catalog # A00002-2. Tested in WB applications. This antibody reacts with Mouse. Cited in 10 publication(s).

Product Info Summary

SKU: A00002-2
Size: 100 μg/vial
Reactive Species: Mouse
Host: Rabbit
Application: WB

Customers Who Bought This Also Bought

Product Name

Anti-TNF alpha Antibody Picoband™

View all TNF-alpha Antibodies

SKU/Catalog Number

A00002-2

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-TNF alpha Antibody Picoband™ catalog # A00002-2. Tested in WB applications. This antibody reacts with Mouse.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-TNF alpha Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00002-2)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of mouse TNF alpha (202-235aa FQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL), different from the related human sequence by five amino acids, and from the related rat sequence by three amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A00002-2 is reactive to Tnf in Mouse

Applications

A00002-2 is guaranteed for WB Boster Guarantee

Background of TNF-alpha

TNFα (Tumor Necrosis Factor alpha) gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. And this cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. Moreover, this cytokine has been implicated in a variety of diseases, including autoimmune diseases, insulin resistance, and cancer. Knockout studies in mice also suggested the neuroprotective function of this cytokine.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Mouse

Validation Images & Assay Conditions

Gene/Protein Information For Tnf (Source: Uniprot.org, NCBI)

Uniprot ID

P06804

Gene ID

21926

Gene Name

Tnf

Full Name

Tumor necrosis factor

Weight

25.896kDa

Superfamily

tumor necrosis factor family

Alternative Names

APC1 protein; Cachectin; Cachetin; DIF; TNF; TNF, monocyte-derived; TNFA; TNF-A; TNFalpha; TNF-alpha; TNF-alphacachectin; TNFATNF, macrophage-derived; TNFG1F; TNFSF1A; TNFSF2; TNFSF2TNF superfamily, member 2; tumor necrosis factor (TNF superfamily, member 2); tumor necrosis factor alpha; Tumor necrosis factor ligand superfamily member 2; tumor necrosis factor; tumor necrosis factor-alpha Tnf|DI, DIF, TNF-, TNF-a, TNF-alpha, TNFSF2, TNFalpha, Tna, Tnfs, Tnfsf1a, Tnlg1f, Tnf|tumor necrosis factor|tumor necrosis factor|cachectin|tumor necrosis factor ligand 1f|tumor necrosis factor ligand superfamily member 2|tumor necrosis factor-alpha

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on Tnf, check out the Tnf Infographic

Tnf infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Tnf: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected]

A00002-2 has been cited in 10 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

The pivotal role of the NLRC4 inflammasome in neuroinflammation after intracerebral hemorrhage in rats

Liao L,Huang L,Wei X,Yin L,Wei X,Li T.Bioinformatic and biochemical studies of formononetin against liver injure.Life Sci.2021 Feb 16:119229.doi:10.1016/j.lfs.2021.119229.Epub ahead of print.PMID:33607154.
Species: Mouse
A00002-2 usage in article: APP:WB, SAMPLE:LIVER TISSUE, DILUTION:NA

Liao L,Huang L,Wei X,Yin L,Wei X,Li T.Bioinformatic and biochemical studies of formononetin against liver injure.Life Sci.2021 Feb 16:119229.doi:10.1016/j.lfs.2021.119229.Epub ahead of print.PMID:33607154.
Species: Mouse
A00002-2 usage in article: APP:WB, SAMPLE:LIVER TISSUE, DILUTION:NA

Ye D,Hu Y,Zhu N,Gu W,Long G,Tao E,Fang M,Jiang M. Exploratory Investigation of Intestinal Structure and Function after Stroke in Mice. Mediators Inflamm.2021 Feb 15;2021:1315797.doi: 10.1155/2021/1315797.PMID:33642941;PMCID:PMC7902147.
Species: Mouse
A00002-2 usage in article: APP:WB, SAMPLE:INTESTINE TISSUE, DILUTION:1:400

Resveratrol attenuates hyperoxia%u2010induced oxidative stress, inflammation and fibrosis and suppresses Wnt/%u03B2%u2010catenin signalling in lungs of neonatal rats

Efficacy of acetylshikonin in preventing obesity and hepatic steatosis in db/db mice

Protective effects of baicalin on carbon tetrachloride induced liver injury by activating PPAR%u03B3 and inhibiting TGF%u03B21

Immunomodulatory properties of quercetin-3-O-%u03B1-L-rhamnopyranoside from Rapanea melanophloeos against influenza a virus

Neuroprotective effects of %u03B1-lipoic acid on long-term experimental autoimmune encephalomyelitis.

Polymeric micelles for potentiated antiulcer and anticancer activities of naringin

Have you used Anti-TNF alpha Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-TNF alpha Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

15 Customer Q&As for Anti-TNF alpha Antibody Picoband™

Question

Do you have a BSA free version of anti-TNF alpha antibody A00002-2 available?

Verified Customer

Verified customer

Asked: 2020-04-28

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-TNF alpha antibody A00002-2 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2020-04-28

Question

Our lab were satisfied with the WB result of your anti-TNF alpha antibody. However we have seen positive staining in leukocyte cell membrane using this antibody. Is that expected? Could you tell me where is TNF supposed to be expressed?

Verified Customer

Verified customer

Asked: 2020-03-09

Answer

Based on literature, leukocyte does express TNF. Generally TNF expresses in cell membrane. Regarding which tissues have TNF expression, here are a few articles citing expression in various tissues:
Blood, Pubmed ID: 15489334
Prostatic carcinoma, Pubmed ID: 8597870, 10205166

Boster Scientific Support

Answered: 2020-03-09

Question

Is a blocking peptide available for product anti-TNF alpha antibody (A00002-2)?

Verified Customer

Verified customer

Asked: 2020-01-23

Answer

We do provide the blocking peptide for product anti-TNF alpha antibody (A00002-2). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2020-01-23

Question

We are interested in using your anti-TNF alpha antibody for extrinsic apoptotic signaling pathway via death domain receptors studies. Has this antibody been tested with western blotting on mouse thymus tissue? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2020-01-08

Answer

We appreciate your inquiry. This A00002-2 anti-TNF alpha antibody is validated on mouse thymus tissue. It is guaranteed to work for WB in mouse. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2020-01-08

Question

I have attached the WB image, lot number and protocol we used for prostatic carcinoma using anti-TNF alpha antibody A00002-2. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-12-25

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-12-25

Question

Will anti-TNF alpha antibody A00002-2 work for WB with prostatic carcinoma?

Verified Customer

Verified customer

Asked: 2019-09-24

Answer

According to the expression profile of prostatic carcinoma, TNF is highly expressed in prostatic carcinoma. So, it is likely that anti-TNF alpha antibody A00002-2 will work for WB with prostatic carcinoma.

Boster Scientific Support

Answered: 2019-09-24

Question

I see that the anti-TNF alpha antibody A00002-2 works with WB, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-09-17

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-09-17

Question

We have observed staining in mouse prostatic carcinoma. Any tips? Is anti-TNF alpha antibody supposed to stain prostatic carcinoma positively?

Verified Customer

Verified customer

Asked: 2019-08-26

Answer

According to literature prostatic carcinoma does express TNF. According to Uniprot.org, TNF is expressed in leukocyte, blood, prostatic carcinoma, among other tissues. Regarding which tissues have TNF expression, here are a few articles citing expression in various tissues:
Blood, Pubmed ID: 15489334
Prostatic carcinoma, Pubmed ID: 8597870, 10205166

Boster Scientific Support

Answered: 2019-08-26

Question

I was wanting to use your anti-TNF alpha antibody for WB for mouse prostatic carcinoma on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for mouse prostatic carcinoma identification?

Verified Customer

Verified customer

Asked: 2019-01-08

Answer

As indicated on the product datasheet, A00002-2 anti-TNF alpha antibody has been validated for WB on mouse tissues. We have an innovator award program that if you test this antibody and show it works in mouse prostatic carcinoma in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-01-08

Question

Is this A00002-2 anti-TNF alpha antibody reactive to the isotypes of TNF?

J. Walker

Verified customer

Asked: 2018-10-15

Answer

The immunogen of A00002-2 anti-TNF alpha antibody is A synthetic peptide corresponding to a sequence at the C-terminus of mouse TNF alpha (202-235aa FQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL), different from the related human sequence by five amino acids, and from the related rat sequence by three amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2018-10-15

Question

I have a question about product A00002-2, anti-TNF alpha antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

D. Kulkarni

Verified customer

Asked: 2017-10-06

Answer

We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00002-2 anti-TNF alpha antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2017-10-06

Question

Will A00002-2 anti-TNF alpha antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

T. Collins

Verified customer

Asked: 2017-09-05

Answer

As indicated on the product datasheet, A00002-2 anti-TNF alpha antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2017-09-05

Question

I am looking for to test anti-TNF alpha antibody A00002-2 on mouse prostatic carcinoma for research purposes, then I may be interested in using anti-TNF alpha antibody A00002-2 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2017-06-21

Answer

The products we sell, including anti-TNF alpha antibody A00002-2, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2017-06-21

Question

Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for prostatic carcinoma using anti-TNF alpha antibody A00002-2. Let me know if you need anything else.

S. Carter

Verified customer

Asked: 2017-05-25

Answer

Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2017-05-25

Question

We are currently using anti-TNF alpha antibody A00002-2 for mouse tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says mouse. Is it true that the antibody can work on pig tissues as well?

B. Kulkarni

Verified customer

Asked: 2015-04-29

Answer

The anti-TNF alpha antibody (A00002-2) has not been validated for cross reactivity specifically with pig tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2015-04-29

Size

Conjugation

Total: $315

SKU:A00002-2

Ask a question

Get A Quote

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

Product Categories

Primary Antibodies

Primary and Secondary Antibodies

Boster Bio offers over 16,000 antibodies that have been validated for IHC, WB, ELISA, and FC in human, mouse, and rat samples. Rabbit and mouse monoclonal antibodies as well as rabbit polyclonal antibodies are available. Buy a primary antibody and get a secondary antibody for free!

ELISA Kits

ELISA Kits

More than 1,000 ELISA kits, both singleplex and multiplex, that have been cited 6,000+ times are available at Boster. We offer our Boster-branded Picokine™ ELISA kits (sandwich ELISA) and EZ-Set™ ELISA kits (DIY antibody pairs) in addition to many multiplex ELISA kits.

Image

Recombinant Proteins

Boster provides a wide range of human, mouse, and rat recombinant proteins, which include cytokines, growth factors, chemokines, and many more. Our recombinant proteins have high stability, biological activity, and purity.

Boster Kit

Reagents

Boster offers all the reagents you need for your immunostaining and western blotting experiments. We've got everything from buffers to lysates to kits, including our popular and well-cited BCA, CCK-8, and MTT assay kits.

In stock
Order Product
A00002-2
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$315.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.