Product Info Summary
SKU: | A02256-1 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-UCP2 Antibody Picoband™
SKU/Catalog Number
A02256-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-UCP2 Antibody Picoband™ catalog # A02256-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-UCP2 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A02256-1)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human UCP2, different from the related mouse and rat sequences by one amino acid.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A02256-1 is reactive to UCP2 in Human, Mouse, Rat
Applications
A02256-1 is guaranteed for WB Boster Guarantee
Observed Molecular Weight
33 kDa
Calculated molecular weight
33.229kDa
Background of UCP2
Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. This gene is expressed in many tissues, with the greatest expression in skeletal muscle. It is thought to play a role in nonshivering thermogenesis, obesity and diabetes. Chromosomal order is 5'-UCP3-UCP2-3'.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of UCP2 using anti-UCP2 antibody (A02256-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat spleen tissue lysate,
Lane 2: rat cardiac muscle tissue lysate,
Lane 3: rat brain tissue lysate,
Lane 4: mouse spleen tissue lysate,
Lane 5: mouse cardiac muscle tissue lysate,
Lane 6: mouse brain tissue lysate,
Lane 7: human Hela whole cell lysate.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-UCP2 antigen affinity purified polyclonal antibody (Catalog # A02256-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for UCP2 at approximately 33KD. The expected band size for UCP2 is at 33KD.
Protein Target Info & Infographic
Gene/Protein Information For UCP2 (Source: Uniprot.org, NCBI)
Gene Name
UCP2
Full Name
Mitochondrial uncoupling protein 2
Weight
33.229kDa
Superfamily
mitochondrial carrier (TC 2.A.29) family
Alternative Names
mitochondrial uncoupling protein 2; SLC25A8; SLC25A8BMIQ4; Solute carrier family 25 member 8; UCP 2; UCP2; UCPH; uncoupling protein 2 (mitochondrial, proton carrier) UCP2 BMIQ4, SLC25A8, UCPH uncoupling protein 2 mitochondrial uncoupling protein 2|solute carrier family 25 member 8|uncoupling protein 2 (mitochondrial, proton carrier)
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on UCP2, check out the UCP2 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for UCP2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-UCP2 Antibody Picoband™ (A02256-1)
Hello CJ!
A02256-1 has been cited in 1 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Exhaustive Training Increases Uncoupling Protein 2 Expression and Decreases Bcl-2/Bax Ratio in Rat Skeletal Muscle
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-UCP2 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
Be the first to review Anti-UCP2 Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
15 Customer Q&As for Anti-UCP2 Antibody Picoband™
Question
Our team were content with the WB result of your anti-UCP2 antibody. However we have observed positive staining in oviduct epithelium mitochondrion inner membrane using this antibody. Is that expected? Could you tell me where is UCP2 supposed to be expressed?
Verified Customer
Verified customer
Asked: 2020-04-30
Answer
From what I have seen in literature, oviduct epithelium does express UCP2. Generally UCP2 expresses in mitochondrion inner membrane. Regarding which tissues have UCP2 expression, here are a few articles citing expression in various tissues:
B-cell, Pubmed ID: 15489334
Lung, and Skeletal muscle, Pubmed ID: 9054939
Placenta, Pubmed ID: 10082652
Skeletal muscle, Pubmed ID: 9180264
Spleen, Pubmed ID: 9133562
Boster Scientific Support
Answered: 2020-04-30
Question
Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for lung skeletal muscle using anti-UCP2 antibody A02256-1. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2020-04-29
Answer
Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-04-29
Question
See below the WB image, lot number and protocol we used for lung skeletal muscle using anti-UCP2 antibody A02256-1. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2020-02-28
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-02-28
Question
Is there a BSA free version of anti-UCP2 antibody A02256-1 available?
Verified Customer
Verified customer
Asked: 2019-12-23
Answer
Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-UCP2 antibody A02256-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2019-12-23
Question
My lab would like to test anti-UCP2 antibody A02256-1 on rat lung skeletal muscle for research purposes, then I may be interested in using anti-UCP2 antibody A02256-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-08-13
Answer
The products we sell, including anti-UCP2 antibody A02256-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-08-13
Question
We have seen staining in human lung skeletal muscle. Any tips? Is anti-UCP2 antibody supposed to stain lung skeletal muscle positively?
Verified Customer
Verified customer
Asked: 2019-08-07
Answer
Based on literature lung skeletal muscle does express UCP2. Based on Uniprot.org, UCP2 is expressed in oviduct epithelium, skeletal muscle, lung skeletal muscle, spleen, placenta, adipose tissue, b-cell, among other tissues. Regarding which tissues have UCP2 expression, here are a few articles citing expression in various tissues:
B-cell, Pubmed ID: 15489334
Lung, and Skeletal muscle, Pubmed ID: 9054939
Placenta, Pubmed ID: 10082652
Skeletal muscle, Pubmed ID: 9180264
Spleen, Pubmed ID: 9133562
Boster Scientific Support
Answered: 2019-08-07
Question
Can you help my question with product A02256-1, anti-UCP2 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-06-26
Answer
We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A02256-1 anti-UCP2 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-06-26
Question
Will anti-UCP2 antibody A02256-1 work for WB with lung skeletal muscle?
Verified Customer
Verified customer
Asked: 2019-06-11
Answer
According to the expression profile of lung skeletal muscle, UCP2 is highly expressed in lung skeletal muscle. So, it is likely that anti-UCP2 antibody A02256-1 will work for WB with lung skeletal muscle.
Boster Scientific Support
Answered: 2019-06-11
Question
We are currently using anti-UCP2 antibody A02256-1 for mouse tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on pig tissues as well?
Verified Customer
Verified customer
Asked: 2018-06-05
Answer
The anti-UCP2 antibody (A02256-1) has not been tested for cross reactivity specifically with pig tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2018-06-05
Question
Our lab want to know about using your anti-UCP2 antibody for positive regulation of cold-induced thermogenesis studies. Has this antibody been tested with western blotting on tissue lysate? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2017-11-27
Answer
Thank you for your inquiry. This A02256-1 anti-UCP2 antibody is validated on rat spleen tissue, tissue lysate, cardiac muscle tissue, brain tissue, mouse spleen tissue, human hela, hela whole cell lysate. It is guaranteed to work for WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2017-11-27
Question
Is this A02256-1 anti-UCP2 antibody reactive to the isotypes of UCP2?
Verified Customer
Verified customer
Asked: 2017-08-22
Answer
The immunogen of A02256-1 anti-UCP2 antibody is A synthetic peptide corresponding to a sequence in the middle region of human UCP2 (134-170aa AQPTDVVKVRFQAQARAGGGRRYQSTVNAYKTIAREE), different from the related mouse and rat sequences by one amino acid. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2017-08-22
Question
Will A02256-1 anti-UCP2 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
J. Wu
Verified customer
Asked: 2017-02-06
Answer
As indicated on the product datasheet, A02256-1 anti-UCP2 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2017-02-06
Question
I was wanting to use your anti-UCP2 antibody for WB for rat lung skeletal muscle on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for rat lung skeletal muscle identification?
R. Krishna
Verified customer
Asked: 2016-07-21
Answer
As indicated on the product datasheet, A02256-1 anti-UCP2 antibody has been tested for WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat lung skeletal muscle in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2016-07-21
Question
I see that the anti-UCP2 antibody A02256-1 works with WB, what is the protocol used to produce the result images on the product page?
D. Kulkarni
Verified customer
Asked: 2014-10-08
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2014-10-08
Question
Is a blocking peptide available for product anti-UCP2 antibody (A02256-1)?
L. Yang
Verified customer
Asked: 2013-03-13
Answer
We do provide the blocking peptide for product anti-UCP2 antibody (A02256-1). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2013-03-13