ARID3C (NM_001017363) Human Recombinant Protein

ARID3C protein,

Recombinant protein of human AT rich interactive domain 3C (BRIGHT-like) (ARID3C)

Product Info Summary

SKU: PROTA6NKF2
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

ARID3C (NM_001017363) Human Recombinant Protein

View all ARID3C recombinant proteins

SKU/Catalog Number

PROTA6NKF2

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human AT rich interactive domain 3C (BRIGHT-like) (ARID3C)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

ARID3C (NM_001017363) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTA6NKF2)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

44.073kDa

Amino Acid Sequence

MEALQKQQAARLAQGVGPLAPACPLLPPQPPLPDHRTLQAPEGALGNVGAEEEEDAEEDEEKREEAGAEEEAAEESRPGAQGPSSPSSQPPGLHPHEWTYEEQFKQLYELDADPKRKEFLDDLFSFMQKRGTPVNRVPIMAKQVLDLYALFRLVTAKGGLVEVINRKVWREVTRGLSLPTTITSAAFTLRTQYMKYLYPYECETRALSSPGELQAAIDSNRREGRRQAYTATPLFGLAGPPPRGAQDPALGPGPAPPATQSSPGPAQGSTSGLPAHACAQLSPSPIKKEESGIPNPCLALPVGLALGPTREKLAPEEPPEKRAVLMGPMDPPRPCMPPSFLPRGKVPLREERLDGPLNLAGSGISSINMALEINGVVYTGVLFARRQPVPASQGPTNPAPPPSTGPPSSILP

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Validation Images & Assay Conditions

Gene/Protein Information For ARID3C (Source: Uniprot.org, NCBI)

Gene Name

ARID3C

Full Name

AT-rich interactive domain-containing protein 3C

Weight

44.073kDa

Alternative Names

ARID domain-containing protein 3C; AT rich interactive domain 3C (BRIGHT- like); AT rich interactive domain 3C (BRIGHT-like); AT-rich interactive domain-containing protein 3C ARID3C AT-rich interaction domain 3C AT-rich interactive domain-containing protein 3C|ARID domain-containing protein 3C|AT rich interactive domain 3C (BRIGHT-like)|Brightlike

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ARID3C, check out the ARID3C Infographic

ARID3C infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ARID3C: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTA6NKF2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ARID3C (NM_001017363) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review ARID3C (NM_001017363) Human Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ARID3C (NM_001017363) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTA6NKF2
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.