BMP-7 Bone Morphogenetic Protein-7 Human Recombinant Protein, Plant

Bone Morphogenetic Protein-7 Human Recombinant produced in Plant is a monomeric, glycosylated, polypeptide chain containing 144 amino acids and having a molecular mass of 16.5kDa, and fused to a 6xHis-tag at the N-terminus.
The BMP-7 is purified by proprietary chromatographic techniques.

Product Info Summary

SKU: PROTP18075
Size: 2ug, 10ug, 1mg
Origin Species: Mouse
Source: Nicotiana benthamiana.
Application: Cell Culture

Product Name

BMP-7 Bone Morphogenetic Protein-7 Human Recombinant Protein, Plant

See all BMP-7 products

SKU/Catalog Number

PROTP18075

Size

2ug, 10ug, 1mg

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Description

Bone Morphogenetic Protein-7 Human Recombinant produced in Plant is a monomeric, glycosylated, polypeptide chain containing 144 amino acids and having a molecular mass of 16.5kDa, and fused to a 6xHis-tag at the N-terminus.
The BMP-7 is purified by proprietary chromatographic techniques.

Storage & Handling

Lyophilized BMP-7 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP 7 Human should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Cite This Product

BMP-7 Bone Morphogenetic Protein-7 Human Recombinant Protein, Plant (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP18075)

Formulation

BMP-7 was lyophilized from a solution containing Tris-HCl 0.05M buffer at pH 7.4.

Predicted MW

49.313kDa

Amino Acid Sequence

HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSVILKKYRNMVVRACGCH.

Biological Activity

The biological activity of BMP-7 was measured by its ability to induce alkaline phosphatase production by ATDC5 cells, ED50

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Validation Images & Assay Conditions

Gene/Protein Information For BMP7 (Source: Uniprot.Org, NCBI)

Uniprot ID

P18075

Gene ID

655

Gene Name

BMP7

Full Name

Bone morphogenetic protein 7

Weight

49.313kDa

Superfamily

TGF-beta family

Alternative Names

BMP7; BMP-7; bone morphogenetic protein 7; Eptotermin alfa; OP-1; OP-1OP1; Osteogenic protein 1 BMP7 OP-1 bone morphogenetic protein 7 bone morphogenetic protein 7|osteogenic protein 1

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on BMP7, check out the BMP7 Infographic

BMP7 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for BMP7: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for PROTP18075

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used BMP-7 Bone Morphogenetic Protein-7 Human Recombinant Protein, Plant?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review BMP-7 Bone Morphogenetic Protein-7 Human Recombinant Protein, Plant

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for BMP-7 Bone Morphogenetic Protein-7 Human Recombinant Protein, Plant

Size

Total: $250

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

In stock
Order Product
PROTP18075
$250.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.