Click image to see more details
Product Info Summary
| SKU: | PROTP18075 |
|---|---|
| Size: | 2ug, 10ug, 1mg |
| Origin Species: | Mouse |
| Source: | Nicotiana benthamiana. |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
BMP-7 Bone Morphogenetic Protein-7 Human Recombinant Protein, Plant
View all BMP-7 recombinant proteins
SKU/Catalog Number
PROTP18075
Size
2ug, 10ug, 1mg
Description
Bone Morphogenetic Protein-7 Human Recombinant produced in Plant is a monomeric, glycosylated, polypeptide chain containing 144 amino acids and having a molecular mass of 16.5kDa, and fused to a 6xHis-tag at the N-terminus.
The BMP-7 is purified by proprietary chromatographic techniques.
Storage & Handling
Lyophilized BMP-7 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP 7 Human should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Cite This Product
BMP-7 Bone Morphogenetic Protein-7 Human Recombinant Protein, Plant (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP18075)
Formulation
BMP-7 was lyophilized from a solution containing Tris-HCl 0.05M buffer at pH 7.4.
Predicted MW
49.313kDa
Amino Acid Sequence
HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSVILKKYRNMVVRACGCH.
Biological Activity
The biological activity of BMP-7 was measured by its ability to induce alkaline phosphatase production by ATDC5 cells, ED50
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists world wide.
Submit A Review
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
Recombinant protein fun image
Protein Target Info & Infographic
Gene/Protein Information For BMP7 (Source: Uniprot.Org, NCBI)
Uniprot ID
P18075
Gene ID
655
Gene Name
BMP7
Full Name
Bone morphogenetic protein 7
Weight
49.313kDa
Superfamily
TGF-beta family
Alternative Names
BMP7; BMP-7; bone morphogenetic protein 7; Eptotermin alfa; OP-1; OP-1OP1; Osteogenic protein 1 BMP7 OP-1 bone morphogenetic protein 7 bone morphogenetic protein 7|osteogenic protein 1
*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".For more info on BMP7, check out the BMP7 Infographic
We have 30,000+ of these available, one for each gene! check them out.
In this infographic you will see the following information for BMP7: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]
Specific Publications For BMP-7 Bone Morphogenetic Protein-7 Human Recombinant Protein, Plant (PROTP18075)
No publications found for PROTP18075
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used BMP-7 Bone Morphogenetic Protein-7 Human Recombinant Protein, Plant?
Submit a review and receive an Amazon gift card.
- $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Submit A Review
Be the first to review BMP-7 Bone Morphogenetic Protein-7 Human Recombinant Protein, Plant
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
