Lamin-A Human Recombinant Protein

LMNA protein, Human

Recombinant Human Lamin A produced in E. coli is a single, non-glycosylated polypeptide chain containing 645 amino acids and having a molecular mass of 70 kDa. Lamin-A protein is fused to a 6xHis tag at N-terminus and purified by conventional chromatography techniques.

Product Info Summary

SKU: PROTP02545
Size: 2ug, 10ug, 100ug
Origin Species: Human
Source: Escherichia coli

Product Name

Lamin-A Human Recombinant Protein

View all LMNA recombinant proteins

SKU/Catalog Number

PROTP02545

Size

2ug, 10ug, 100ug

Description

Recombinant Human Lamin A produced in E. coli is a single, non-glycosylated polypeptide chain containing 645 amino acids and having a molecular mass of 70 kDa. Lamin-A protein is fused to a 6xHis tag at N-terminus and purified by conventional chromatography techniques.

Storage & Handling

Store at 4°C if entire vial will be used within 2-4 weeks. Store frozen at -20°C for longer periods of time. Avoid multiple freeze-thaw cycles.

Cite This Product

Lamin-A Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP02545)

Form

Sterile filtered colorless solution.

Formulation

The Lamin-A Protein solution (0.9mg/ml) contains 20mM phosphate buffer pH 7.0, 500mM NaCl, 1mM DTT, 1.5mM EDTA and 20% (v/v) Glycerol.

Purity

Greater than 90.0% as determined by SDS-PAGE.

Predicted MW

74.139kDa

Amino Acid Sequence

METPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVHSLETENAGLRLRITES EEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQA RLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRL QTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQYKKE LEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLA RERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSP TSQRSRGRASSHSSQTQGGGSVTKKRKLESTESRSSFSQHARTSGRVAVEEVDEEGKFVRLRN KSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNT WGCGNSLRTALINSTGEEVAMRKLVRSVTVVEDDEDEDGDDLLHHHHGSHCSSSGDPAEYNLRS RTVLCGTCGQPADKASASGSGAQVGGPISSGSSASSVTVTRSYRSVGGSGGGSFGDNLVTRS>

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Validation Images & Assay Conditions

There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.

Gene/Protein Information For LMNA (Source: Uniprot.org, NCBI)

Gene Name

LMNA

Full Name

Prelamin-A/C

Weight

74.139kDa

Superfamily

intermediate filament family

Alternative Names

CDCD1; CDDC; CMD1A; CMT2B1; dilated 1A (autosomal dominant); EMD2; FPLD; HGPSFPL; lamin A/C; lamin A/C-like 1; lamin-A/C; LDP1; LFP; LGMD1B; limb girdle muscular dystrophy 1B (autosomal dominant); LMN1IDC; LMNC; LMNL1; prelamin-A/C; PRO1,70 kDa lamin; progeria 1 (Hutchinson-Gilford type); renal carcinoma antigen NY-REN-32 LMNA CDCD1, CDDC, CMD1A, CMT2B1, EMD2, FPL, FPLD, FPLD2, HGPS, IDC, LDP1, LFP, LGMD1B, LMN1, LMNC, LMNL1, MADA, PRO1 lamin A/C lamin|70 kDa lamin|epididymis secretory sperm binding protein|lamin A/C-like 1|mandibuloacral dysplasia type A|prelamin-A/C|renal carcinoma antigen NY-REN-32

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on LMNA, check out the LMNA Infographic

LMNA infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for LMNA: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP02545

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Lamin-A Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Lamin-A Human Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Lamin-A Human Recombinant Protein

Size

Total: $250

SKU:PROTP02545

Backordered.

Lead time for this item is typically 10-14 days

Get A Quote
Eddy test
In stock
Order Product
PROTP02545
$250.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.