LOX 1 (OLR1) (NM_002543) Human Recombinant Protein

LOX-1/OLR1 protein,

Product Info Summary

SKU: PROTP78380
Size: 20 µg
Source: HEK293T

Product Name

LOX 1 (OLR1) (NM_002543) Human Recombinant Protein

View all LOX-1/OLR1 recombinant proteins

SKU/Catalog Number

PROTP78380

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human oxidized low density lipoprotein (lectin-like) receptor 1 (OLR1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

LOX 1 (OLR1) (NM_002543) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP78380)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

30.959kDa

Amino Acid Sequence

MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Validation Images & Assay Conditions

Gene/Protein Information For OLR1 (Source: Uniprot.org, NCBI)

Gene Name

OLR1

Full Name

Oxidized low-density lipoprotein receptor 1

Weight

30.959kDa

Alternative Names

CLEC8A; CLEC8ASLOX1; C-type lectin domain family 8 member A; hLOX-1; Lectin-like oxidized LDL receptor 1; Lectin-like oxLDL receptor 1; Lectin-type oxidized LDL receptor 1; LOX1; LOX-1; LOX1ox LDL receptor 1; LOXIN; OLR1; oxidised low density lipoprotein (lectin-like) receptor 1; oxidized low density lipoprotein (lectin-like) receptor 1; oxidized low-density lipoprotein receptor 1; oxidized low-density lipoprotein receptor 1, soluble form; Ox-LDL receptor 1; SCARE1; scavenger receptor class E, member 1; SR-E1 OLR1 CLEC8A, LOX1, LOXIN, SCARE1, SLOX1 oxidized low density lipoprotein receptor 1 oxidized low-density lipoprotein receptor 1|C-type lectin domain family 8 member A|hLOX-1|lectin-type oxidized LDL receptor 1|ox LDL receptor 1|oxidized low density lipoprotein (lectin-like) receptor 1|oxidized low-density lipoprotein receptor 1, soluble form|scavenger receptor class E, member 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on OLR1, check out the OLR1 Infographic

OLR1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for OLR1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP78380

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used LOX 1 (OLR1) (NM_002543) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review LOX 1 (OLR1) (NM_002543) Human Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for LOX 1 (OLR1) (NM_002543) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP78380
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.