Click image to see more details
Product Info Summary
| SKU: | PROTP23368 |
|---|---|
| Size: | 5ug, 25ug, 1mg |
| Origin Species: | Human |
| Source: | Escherichia coli |
Customers Who Bought This Also Bought
Product info
Product Name
ME2 Malic Enzyme 2 Human Recombinant Protein
View all ME2 recombinant proteins
SKU/Catalog Number
PROTP23368
Size
5ug, 25ug, 1mg
Description
ME2 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 573 amino acids and having a total molecular mass of 64.4kDa. ME2 is purified by proprietary chromatographic techniques.
Storage & Handling
Lyophilized ME2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution ME2 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
Cite This Product
ME2 Malic Enzyme 2 Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP23368)
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
The protein was Lyophilized from a 0.2µm filtered concentrated solution in 20mM Tris, 150mM NaCl, 1mM b-mercaptoethanol, 1mM EDTA, pH8.0.
Purity
Greater than 95.0% as determined by (a) Analysis by HPLC and (b) Analysis by SDS-PAGE.
Predicted MW
65.444kDa
Reconstitution
It is recommended to reconstitute the lyophilized ME2 in sterile 18M-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Amino Acid Sequence
MLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLK KMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGL FISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTAC AGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYG RNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEH KILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQ EPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPT AQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILC NTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAF RYPEPEDKAKYVKERTWRSEYDSLLPDVYEWPESASSPPVITEHHHHHH
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconstitution
It is recommended to reconstitute the lyophilized ME2 in sterile 18M-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Validation Images & Assay Conditions
Click image to see more details
Recombinant protein fun image
Protein Target Info & Infographic
Gene/Protein Information For ME2 (Source: Uniprot.org, NCBI)
Gene Name
ME2
Full Name
NAD-dependent malic enzyme, mitochondrial
Weight
65.444kDa
Superfamily
malic enzymes family
Alternative Names
EC 1.1.1; EC 1.1.1.38; malate dehydrogenase; Malic enzyme 2; malic enzyme 2, NAD(+)-dependent, mitochondrial; NAD-dependent malic enzyme, mitochondrial; NAD-ME; ODS1; pyruvic-malic carboxylase ME2 ODS1 malic enzyme 2 NAD-dependent malic enzyme, mitochondrial|NAD-ME|malate dehydrogenase (oxaloacetate-decarboxylating)|malic enzyme 2, NAD(+)-dependent, mitochondrial|pyruvic-malic carboxylase
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on ME2, check out the ME2 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for ME2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For ME2 Malic Enzyme 2 Human Recombinant Protein (PROTP23368)
Hello CJ!
No publications found for PROTP23368
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used ME2 Malic Enzyme 2 Human Recombinant Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
Be the first to review ME2 Malic Enzyme 2 Human Recombinant Protein
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
