Product Info Summary
SKU: | PB10022 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | Flow Cytometry, IF, IHC, IHC-F, ICC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-ACAA2 Antibody Picoband™
SKU/Catalog Number
PB10022
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-ACAA2 Antibody Picoband™ catalog # PB10022. Tested in Flow Cytometry, IF, IHC, IHC-F, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-ACAA2 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB10022)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human ACAA2, different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB10022 is reactive to ACAA2 in Human, Mouse, Rat
Applications
PB10022 is guaranteed for Flow Cytometry, IF, IHC, IHC-F, ICC, WB Boster Guarantee
Observed Molecular Weight
42 kDa
Calculated molecular weight
41.924kDa
Background of ACAA2
3-Ketoacyl-CoA thiolase, mitochondrial, also known as acetyl-Coenzyme A acyltransferase 2, is an acetyl-CoA C-acyltransferase enzyme that in humans is encoded by the ACAA2 gene. The ACAA2 gene encodes a 41.9 kDa protein that is composed of 397 amino acids and contains 88 observed peptides. The encoded protein catalyzes the last step of themitochondrial fatty acid beta oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal. Additionally, ACAA2 has been shown to be a functional BNIP3 binding partner, which provides a possible link between fatty acid metabolism and cell apoptosis.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Immunohistochemistry (Frozen Section), 0.5-1μg/ml, Human
Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
Flow Cytometry, 1-3μg/1x106 cells, Human
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of ACAA2 using anti-ACAA2 antibody (PB10022).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: rat liver tissue lysates,
Lane 2: rat lung tissue lysates,
Lane 3: rat brain tissue lysates,
Lane 4: rat kidney tissue lysates,
Lane 5: human Hela whole cell lysates,
Lane 6: mouse HEPA1-6 whole cell lysates,
Lane 7: mouse NIH/3T3 whole cell lysates,
Lane 8: mouse SP2/0 whole cell lysates,
Lane 9: mouse lung tissue lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-ACAA2 antigen affinity purified polyclonal antibody (Catalog # PB10022) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for ACAA2 at approximately 42 kDa. The expected band size for ACAA2 is at 42 kDa.
Click image to see more details
Figure 2. IHC analysis of ACAA2 using anti-ACAA2 antibody (PB10022).
ACAA2 was detected in paraffin-embedded section of human intestinal cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-ACAA2 Antibody (PB10022) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. IF analysis of ACAA2 using anti-ACAA2 antibody (PB10022).
ACAA2 was detected in immunocytochemical section of U20S cell. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 2μg/mL rabbit anti-ACAA2 Antibody ((PB10022) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG (BA1127) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Click image to see more details
Figure 4. Flow Cytometry analysis of HepG2 cells using anti-ACAA2 antibody (PB10022).
Overlay histogram showing HepG2 cells stained with PB10022 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-ACAA2 Antibody (PB10022,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Protein Target Info & Infographic
Gene/Protein Information For ACAA2 (Source: Uniprot.org, NCBI)
Gene Name
ACAA2
Full Name
3-ketoacyl-CoA thiolase, mitochondrial
Weight
41.924kDa
Superfamily
thiolase-like superfamily
Alternative Names
3-ketoacyl-CoA thiolase, mitochondrial; acetyl-CoA acyltransferase 2; Acetyl-CoA acyltransferase; acetyl-Coenzyme A acyltransferase 2; beta ketothiolase; beta-ketothiolase; DSAEC; EC 2.3.1; EC 2.3.1.16; FLJ35992; FLJ95265; Mitochondrial 3-oxoacyl-CoA thiolase; mitochondrial 3-oxoacyl-Coenzyme A thiolase; T1 ACAA2 DSAEC acetyl-CoA acyltransferase 2 3-ketoacyl-CoA thiolase, mitochondrial|T1|acetyl-CoA acetyltransferase|acetyl-Coenzyme A acyltransferase 2|acyl-CoA hydrolase, mitochondrial|beta ketothiolase|mitochondrial 3-oxoacyl-CoA thiolase|mitochondrial 3-oxoacyl-Coenzyme A thiolase
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on ACAA2, check out the ACAA2 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for ACAA2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-ACAA2 Antibody Picoband™ (PB10022)
Hello CJ!
No publications found for PB10022
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-ACAA2 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
Be the first to review Anti-ACAA2 Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
4 Customer Q&As for Anti-ACAA2 Antibody Picoband™
Question
Is this PB10022 anti-ACAA2 antibody reactive to the isotypes of ACAA2?
L. Miller
Verified customer
Asked: 2019-10-23
Answer
The immunogen of PB10022 anti-ACAA2 antibody is A synthetic peptide corresponding to a sequence in the middle region of human ACAA2 (207-242aa EVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKKD), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-10-23
Question
We are currently using anti-ACAA2 antibody PB10022 for mouse tissue, and we are content with the IF results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on pig tissues as well?
Verified Customer
Verified customer
Asked: 2019-08-20
Answer
The anti-ACAA2 antibody (PB10022) has not been validated for cross reactivity specifically with pig tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-08-20
Question
See attached the WB image, lot number and protocol we used for cervix carcinoma using anti-ACAA2 antibody PB10022. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-06-25
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-06-25
Question
Is a blocking peptide available for product anti-ACAA2 antibody (PB10022)?
Verified Customer
Verified customer
Asked: 2018-09-21
Answer
We do provide the blocking peptide for product anti-ACAA2 antibody (PB10022). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2018-09-21