Anti-AKR1B10 Antibody Picoband™

Aldo-keto Reductase 1B10/AKR1B10 antibody

Boster Bio Anti-AKR1B10 Antibody Picoband™ catalog # A02976. Tested in IF, IHC, ICC, WB applications. This antibody reacts with Human. Cited in 1 publication(s).

Product Info Summary

SKU: A02976
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: IF, IHC, ICC, WB

Product Name

Anti-AKR1B10 Antibody Picoband™

View all Aldo-keto Reductase 1B10/AKR1B10 Antibodies

SKU/Catalog Number

A02976

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-AKR1B10 Antibody Picoband™ catalog # A02976. Tested in IF, IHC, ICC, WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-AKR1B10 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A02976)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human AKR1B10.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

A02976 is reactive to AKR1B10 in Human

Applications

A02976 is guaranteed for IF, IHC, ICC, WB Boster Guarantee

Observed Molecular Weight

36 kDa

Calculated molecular weight

36.02kDa

Background of Aldo-keto Reductase 1B10/AKR1B10

Aldo-keto reductase family 1 member B10 is an enzyme that in humans is encoded by the AKR1B10 gene. This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Immunocytochemistry/Immunofluorescence, 5 μg/ml, Human

Validation Images & Assay Conditions

Gene/Protein Information For AKR1B10 (Source: Uniprot.org, NCBI)

Gene Name

AKR1B10

Full Name

Aldo-keto reductase family 1 member B10

Weight

36.02kDa

Superfamily

aldo/keto reductase family

Alternative Names

AKR1B10; AKR1B11; AKR1B12; Aldo-keto Reductase 1B10; aldo-keto reductase family 1 member B10; aldo-keto reductase family 1, member B10 (aldose reductase); aldo-keto reductase family 1, member B11 (aldose reductase-like); AldoketoReductase 1B10; aldose reductase-like 1; aldose reductase-like peptide; Aldose reductase-like; Aldose reductase-related protein; ALDRLn; ARL1; ARL-1SI reductase; ARP; EC 1.1.1; EC 1.1.1.-; EC 1.1.1.21; hARP; HIS; HSI; MGC14103; Small intestine reductase AKR1B10 AKR1B11, AKR1B12, ALDRLn, ARL-1, ARL1, HIS, HSI aldo-keto reductase family 1 member B10 aldo-keto reductase family 1 member B10|ARP|SI reductase|aldo-keto reductase family 1, member B10 (aldose reductase)|aldo-keto reductase family 1, member B11 (aldose reductase-like)|aldose reductase-like 1|aldose reductase-like peptide|aldose reductase-related protein|hARP|small intestine reductase

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on AKR1B10, check out the AKR1B10 Infographic

AKR1B10 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for AKR1B10: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

A02976 has been cited in 1 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Loss of AKR1B10 promotes colorectal cancer cells proliferation and migration via regulating FGF1-dependent pathway

Have you used Anti-AKR1B10 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review Anti-AKR1B10 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

7 Customer Q&As for Anti-AKR1B10 Antibody Picoband™

Question

Is there a BSA free version of anti-AKR1B10 antibody A02976 available?

Verified Customer

Verified customer

Asked: 2020-02-20

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-AKR1B10 antibody A02976 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2020-02-20

Question

Would anti-AKR1B10 antibody A02976 work for IHC with small intestine?

Verified Customer

Verified customer

Asked: 2019-12-17

Answer

According to the expression profile of small intestine, AKR1B10 is highly expressed in small intestine. So, it is likely that anti-AKR1B10 antibody A02976 will work for IHC with small intestine.

Boster Scientific Support

Answered: 2019-12-17

Question

We are currently using anti-AKR1B10 antibody A02976 for human tissue, and we are happy with the IHC results. The species of reactivity given in the datasheet says human. Is it possible that the antibody can work on dog tissues as well?

Verified Customer

Verified customer

Asked: 2019-10-18

Answer

The anti-AKR1B10 antibody (A02976) has not been tested for cross reactivity specifically with dog tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-10-18

Question

My lab would like to test anti-AKR1B10 antibody A02976 on human small intestine for research purposes, then I may be interested in using anti-AKR1B10 antibody A02976 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-06-05

Answer

The products we sell, including anti-AKR1B10 antibody A02976, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-06-05

Question

Is this A02976 anti-AKR1B10 antibody reactive to the isotypes of AKR1B10?

Verified Customer

Verified customer

Asked: 2018-01-16

Answer

The immunogen of A02976 anti-AKR1B10 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human AKR1B10 (285-316aa EMATILSFNRNWRACNVLQSSHLEDYPFNAEY). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2018-01-16

Question

Would anti-AKR1B10 antibody A02976 work on bovine WB with small intestine?

Verified Customer

Verified customer

Asked: 2017-06-02

Answer

Our lab technicians have not validated anti-AKR1B10 antibody A02976 on bovine. You can run a BLAST between bovine and the immunogen sequence of anti-AKR1B10 antibody A02976 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated bovine samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in bovine small intestine in WB, you can get your next antibody for free.

Boster Scientific Support

Answered: 2017-06-02

Question

Does A02976 anti-AKR1B10 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

O. Zhang

Verified customer

Asked: 2014-08-11

Answer

As indicated on the product datasheet, A02976 anti-AKR1B10 antibody as been tested on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2014-08-11

Order DetailsPrice
A02976

100μg

$370
A02976-10ug

10μg sample (liquid)

$99
A02976-Biotin

100 μg Biotin conjugated

$570
A02976-Cy3

100 μg Cy3 conjugated

$570
A02976-Dylight488

100 μg Dylight488 conjugated

$570
A02976-Dylight550

100 μg Dylight550 conjugated

$570
A02976-Dylight594

100 μg Dylight594 conjugated

$570
A02976-FITC

100 μg FITC conjugated

$570
A02976-HRP

100 μg HRP conjugated

$570
A02976-APC

100 μg APC conjugated

$670
A02976-PE

100 μg PE conjugated

$670
A02976-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A02976
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.