Product Info Summary
SKU: | A12967 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Amylase/AMY1A/AMY1B/AMY1C Antibody Picoband™
View all Salivary Amylase Alpha Antibodies
SKU/Catalog Number
A12967
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Amylase/AMY1A/AMY1B/AMY1C Antibody Picoband™ catalog # A12967. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Amylase/AMY1A/AMY1B/AMY1C Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A12967)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Alpha Amylase 1, different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
A12967 is reactive to AMY1A in Human, Mouse, Rat
Applications
A12967 is guaranteed for IHC, WB Boster Guarantee
Observed Molecular Weight
58 kDa
Calculated molecular weight
57.768kDa
Background of Salivary Amylase Alpha
Amylase is an enzyme that catalyses the breakdown of starch into sugars. Amylase is present in human saliva, where it begins the chemical process of digestion. By in situ hybridization combined with high resolution cytogenetics, the amylase gene is mapped to 1p21. Amylase enzymes find use in bread making and to break down complex sugars such as starch (found in flour) into simple sugars. Yeast then feeds on these simple sugars and converts it into the waste products of alcohol and CO2.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Western blot, 0.1-0.5μg/ml, Mouse, Rat, Human
Validation Images & Assay Conditions
Click image to see more details
Figure 2. IHC analysis of Amylase using anti-Amylase antibody (A12967).
Amylase was detected in paraffin-embedded section of human pancreatic cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-Amylase Antibody (A12967) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 1. Western blot analysis of Amylase using anti-Amylase antibody (A12967).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat pancreas tissue lysates,
Lane 2: mouse pancreas tissue lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Amylase antigen affinity purified polyclonal antibody (Catalog # A12967) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Amylase at approximately 58KD. The expected band size for Amylase is at 58KD.
Protein Target Info & Infographic
Gene/Protein Information For AMY1A (Source: Uniprot.org, NCBI)
Gene Name
AMY1A
Full Name
Alpha-amylase 1
Weight
57.768kDa
Superfamily
glycosyl hydrolase 13 family
Alternative Names
1,4-alpha-D-glucan glucanohydrolase 1; alpha-amylase 1; AMY1; AMY1B; AMY1C; amylase, alpha 1A (salivary); amylase, alpha 1A; salivary; amylase, salivary, alpha-1A; EC 3.2.1.1; glycogenase; Salivary alpha-amylase; salivary amylase alpha 1A AMY1A AMY1 amylase alpha 1A alpha-amylase 1A|1,4-alpha-D-glucan glucanohydrolase 1|alpha-amylase 1|amylase alpha 1A (salivary)|amylase, salivary, alpha-1A|glycogenase|salivary alpha-amylase|salivary amylase alpha 1A
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on AMY1A, check out the AMY1A Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for AMY1A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Amylase/AMY1A/AMY1B/AMY1C Antibody Picoband™ (A12967)
Hello CJ!
A12967 has been cited in 1 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Isolation and characterization of a novel oncogene, amplified in liver cancer 1, within a commonly amplified region at 1q21 in hepatocellular carcinoma
Species: Human
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Amylase/AMY1A/AMY1B/AMY1C Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
Be the first to review Anti-Amylase/AMY1A/AMY1B/AMY1C Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
4 Customer Q&As for Anti-Amylase/AMY1A/AMY1B/AMY1C Antibody Picoband™
Question
See below the WB image, lot number and protocol we used for thyroid using anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C antibody A12967. Please let me know if you require anything else.
H. Jones
Verified customer
Asked: 2019-03-29
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-03-29
Question
Would anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C antibody A12967 work on horse WB with thyroid?
L. Walker
Verified customer
Asked: 2018-12-10
Answer
Our lab technicians have not validated anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C antibody A12967 on horse. You can run a BLAST between horse and the immunogen sequence of anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C antibody A12967 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated horse samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in horse thyroid in WB, you can get your next antibody for free.
Boster Scientific Support
Answered: 2018-12-10
Question
We are interested in to test anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C antibody A12967 on human thyroid for research purposes, then I may be interested in using anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C antibody A12967 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2018-02-06
Answer
The products we sell, including anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C antibody A12967, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2018-02-06
Question
Is this A12967 anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C antibody reactive to the isotypes of AMY1A?
S. Collins
Verified customer
Asked: 2017-07-19
Answer
The immunogen of A12967 anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human Alpha Amylase 1 (20-50aa NTQQGRTSIVHLFEWRWVDIALECERYLAPK), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2017-07-19