Anti-Argonaute 4/AGO4 Antibody Picoband™

Ago4 antibody

Boster Bio Anti-Argonaute 4/AGO4 Antibody Picoband™ catalog # PB9979. Tested in WB applications. This antibody reacts with Human, Rat.

Product Info Summary

SKU: PB9979
Size: 100 μg/vial
Reactive Species: Human, Rat
Host: Rabbit
Application: WB

Customers Who Bought This Also Bought

Product Name

Anti-Argonaute 4/AGO4 Antibody Picoband™

View all Ago4 Antibodies

SKU/Catalog Number

PB9979

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Argonaute 4/AGO4 Antibody Picoband™ catalog # PB9979. Tested in WB applications. This antibody reacts with Human, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Argonaute 4/AGO4 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9979)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human Argonaute 4, identical to the related mouse sequence.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

PB9979 is reactive to Ago4 in Human, Rat

Applications

PB9979 is guaranteed for WB Boster Guarantee

Observed Molecular Weight

115 kDa

Calculated molecular weight

97.037kDa

Background of Ago4

AGO4 (Argonaute 4) is also known as EIF2C4. This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic containing PAZ and PIWI domains, and it may play a role in short-interfering-RNA-mediated gene silencing. This gene is located on chromosome 1 in a cluster of closely related family members including argonaute 3, and eukaryotic translation initiation factor 2C, 1.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Rat

Validation Images & Assay Conditions

Gene/Protein Information For Ago4 (Source: Uniprot.org, NCBI)

Gene Name

Ago4

Full Name

Protein argonaute-4

Weight

97.037kDa

Superfamily

argonaute family

Alternative Names

Protein argonaute-4 Ago4|5730550L01Rik, AI481660, Eif2c, Eif2c4|argonaute RISC catalytic subunit 4|protein argonaute-4|Piwi/Argonaute family protein meIF2C4|argonaute 4|argonaute RISC catalytic component 4|eukaryotic translation initiation factor 2C, 4

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on Ago4, check out the Ago4 Infographic

Ago4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Ago4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for PB9979

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Argonaute 4/AGO4 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review Anti-Argonaute 4/AGO4 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

5 Customer Q&As for Anti-Argonaute 4/AGO4 Antibody Picoband™

Question

Is this PB9979 anti-Argonaute 4/AGO4 antibody reactive to the isotypes of AGO4?

Verified Customer

Verified customer

Asked: 2020-02-10

Answer

The immunogen of PB9979 anti-Argonaute 4/AGO4 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human Argonaute 4 (114-153aa KDQTFKVSVQWVSVVSLQLLLEALAGHLNEVPDDSVQALD), identical to the related mouse sequence. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-02-10

Question

We are currently using anti-Argonaute 4/AGO4 antibody PB9979 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, rat. Is it likely that the antibody can work on bovine tissues as well?

Verified Customer

Verified customer

Asked: 2019-08-20

Answer

The anti-Argonaute 4/AGO4 antibody (PB9979) has not been validated for cross reactivity specifically with bovine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in bovine you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-08-20

Question

Would anti-Argonaute 4/AGO4 antibody PB9979 work for WB with frontal cortex?

Verified Customer

Verified customer

Asked: 2019-06-10

Answer

According to the expression profile of frontal cortex, AGO4 is highly expressed in frontal cortex. So, it is likely that anti-Argonaute 4/AGO4 antibody PB9979 will work for WB with frontal cortex.

Boster Scientific Support

Answered: 2019-06-10

Question

Would anti-Argonaute 4/AGO4 antibody PB9979 work on feline WB with brain?

Verified Customer

Verified customer

Asked: 2019-04-30

Answer

Our lab technicians have not tested anti-Argonaute 4/AGO4 antibody PB9979 on feline. You can run a BLAST between feline and the immunogen sequence of anti-Argonaute 4/AGO4 antibody PB9979 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated feline samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in feline brain in WB, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-04-30

Question

I see that the anti-Argonaute 4/AGO4 antibody PB9979 works with WB, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2018-10-18

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2018-10-18

Order DetailsPrice
PB9979

100μg

$370
PB9979-10ug

10μg sample (liquid)

$99
PB9979-Biotin

100 μg Biotin conjugated

$570
PB9979-Cy3

100 μg Cy3 conjugated

$570
PB9979-Dylight488

100 μg Dylight488 conjugated

$570
PB9979-Dylight550

100 μg Dylight550 conjugated

$570
PB9979-Dylight594

100 μg Dylight594 conjugated

$570
PB9979-FITC

100 μg FITC conjugated

$570
PB9979-HRP

100 μg HRP conjugated

$570
PB9979-APC

100 μg APC conjugated

$670
PB9979-PE

100 μg PE conjugated

$670
PB9979-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9979
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.